MUL1 antibody (Middle Region)
-
- Target See all MUL1 Antibodies
- MUL1 (Mitochondrial E3 Ubiquitin Protein Ligase 1 (MUL1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MUL1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C1 ORF166 antibody was raised against the middle region of C1 rf166
- Purification
- Affinity purified
- Immunogen
- C1 ORF166 antibody was raised using the middle region of C1 rf166 corresponding to a region with amino acids KPLDSVDLGLETVYEKFHPSIQSFTDVIGHYISGERPKGIQETEEMLKVG
- Top Product
- Discover our top product MUL1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C1ORF166 Blocking Peptide, catalog no. 33R-4589, is also available for use as a blocking control in assays to test for specificity of this C1ORF166 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF166 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MUL1 (Mitochondrial E3 Ubiquitin Protein Ligase 1 (MUL1))
- Alternative Name
- C1ORF166 (MUL1 Products)
- Synonyms
- C1orf166 antibody, GIDE antibody, MAPL antibody, MULAN antibody, RNF218 antibody, RP11-401M16.2 antibody, mul1 antibody, zgc:92166 antibody, 0610009K11Rik antibody, AV000801 antibody, Gide antibody, RGD1309944 antibody, im:7146383 antibody, zgc:165594 antibody, mitochondrial E3 ubiquitin protein ligase 1 antibody, mitochondrial E3 ubiquitin protein ligase 1 L homeolog antibody, mitochondrial E3 ubiquitin protein ligase 1a antibody, mitochondrial ubiquitin ligase activator of NFKB 1 antibody, mitochondrial E3 ubiquitin protein ligase 1b antibody, MUL1 antibody, mul1.L antibody, mul1a antibody, Mul1 antibody, mul1b antibody
- Background
- C1orf166 encodes an ubiquitin-protein ligase that plays a role in the control of mitochondrial morphology. Promotes mitochondrial fragmentation and influences mitochondrial localization. Inhibits cell growth. When overexpressed, activates JNK through MAP3K7/TAK1 and induces caspase-dependent apoptosis. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.
- Molecular Weight
- 40 kDa (MW of target protein)
- Pathways
- Positive Regulation of Endopeptidase Activity
-