TCTA antibody (Middle Region)

Catalog No. ABIN635313

Product Details anti-TCTA Antibody

Target: TCTA (T-Cell Leukemia Translocation Altered (TCTA))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TCTA antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TCTA antibody was raised against the middle region of TCTA

Purification: Affinity purified

Immunogen: TCTA antibody was raised using the middle region of TCTA corresponding to a region with amino acids IQLAWGFYGNTVTGLYHRPGLGGQNGSTPDGSTHFPSWEMAANEPLKTHR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TCTA Blocking Peptide, catalog no. 33R-4114, is also available for use as a blocking control in assays to test for specificity of this TCTA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TCTA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TCTA

Target: TCTA (T-Cell Leukemia Translocation Altered (TCTA))

Alternative Name: TCTA (TCTA Products)

Synonyms: PXYLT2 antibody, XT-II antibody, XT2 antibody, xylT-II antibody, 9130410M22Rik antibody, AW553637 antibody, C85065 antibody, Tctal antibody, wu:fb06g04 antibody, zgc:92721 antibody, xylosyltransferase 2 antibody, T-cell leukemia translocation altered antibody, T cell leukemia translocation altered gene antibody, T-cell leukemia translocation altered S homeolog antibody, T-cell leukemia translocation altered gene antibody, XYLT2 antibody, TCTA antibody, Tcta antibody, tcta.S antibody, tcta antibody

Background: A chromosomal aberration, translocation t(1,3)(p34,p21), involving TCTA is associated with T-cell acute lymphoblastic leukemia (T-ALL).

Molecular Weight: 11 kDa (MW of target protein)