NRSN2 antibody (Middle Region)
-
- Target See all NRSN2 Antibodies
- NRSN2 (Neurensin 2 (NRSN2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NRSN2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Neurensin 2 antibody was raised against the middle region of NRSN2
- Purification
- Affinity purified
- Immunogen
- Neurensin 2 antibody was raised using the middle region of NRSN2 corresponding to a region with amino acids LLLLLGVAALTTGYAVPPKLEGIGEGEFLVLDQRAADYNQALGTCRLAGT
- Top Product
- Discover our top product NRSN2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Neurensin 2 Blocking Peptide, catalog no. 33R-5159, is also available for use as a blocking control in assays to test for specificity of this Neurensin 2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NRSN2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NRSN2 (Neurensin 2 (NRSN2))
- Alternative Name
- Neurensin 2 (NRSN2 Products)
- Synonyms
- C20orf98 antibody, dJ1103G7.6 antibody, Gm123 antibody, Neurensin-2 antibody, neurensin 2 antibody, NRSN2 antibody, Nrsn2 antibody
- Background
- NRSN2 may play a role in maintenance and/or transport of vesicles.
- Molecular Weight
- 22 kDa (MW of target protein)
-