ART3 antibody (Middle Region)

Catalog No. ABIN635414

Product Details anti-ART3 Antibody

Target: ART3 (ADP-Ribosyltransferase 3 (ART3))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ART3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ART3 antibody was raised against the middle region of ART3

Purification: Affinity purified

Immunogen: ART3 antibody was raised using the middle region of ART3 corresponding to a region with amino acids LEPTQIPAPGPVPVPGPKSHPSASSGKLLLPQFGMVIILISVSAINLFVA

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ART3 Blocking Peptide, catalog no. 33R-4921, is also available for use as a blocking control in assays to test for specificity of this ART3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ART3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ART3

Target: ART3 (ADP-Ribosyltransferase 3 (ART3))

Alternative Name: ART3 (ART3 Products)

Synonyms: ARTC3 antibody, 4930569O04Rik antibody, ART3 antibody, DKFZp468P1925 antibody, ADP-ribosyltransferase 3 antibody, ART3 antibody, Art3 antibody

Background: ADP-ribosylation is a reversible posttranslational modification used to regulate protein function.

Molecular Weight: 40 kDa (MW of target protein)