TNMD antibody (N-Term)

Catalog No. ABIN635478

Product Details anti-TNMD Antibody

Target: TNMD (Tenomodulin (TNMD))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TNMD antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Tenomodulin antibody was raised against the N terminal of TNMD

Purification: Affinity purified

Immunogen: Tenomodulin antibody was raised using the N terminal of TNMD corresponding to a region with amino acids KKKIYMEIDPVTRTEIFRSGNGTDETLEVHDFKNGYTGIYFVGLQKCFIK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Tenomodulin Blocking Peptide, catalog no. 33R-4477, is also available for use as a blocking control in assays to test for specificity of this Tenomodulin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNMD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TNMD

Target: TNMD (Tenomodulin (TNMD))

Alternative Name: Tenomodulin (TNMD Products)

Synonyms: zgc:172161 antibody, TeM antibody, BRICD4 antibody, CHM1L antibody, TEM antibody, 1110017I01Rik antibody, Bricd4 antibody, ChM1L antibody, tenomodulin antibody, TNMD antibody, tnmd antibody, Tnmd antibody

Background: TNMD is a single-pass type II membrane proteinPotential. It belongs to the chondromodulin-1 family and contains 1 BRICHOS domain. TNMD may be an angiogenesis inhibitor.

Molecular Weight: 37 kDa (MW of target protein)