ELFN2 antibody (N-Term)

Catalog No. ABIN635494

Product Details anti-ELFN2 Antibody

Target: ELFN2 (Extracellular Leucine-Rich Repeat and Fibronectin Type III Domain Containing 2 (ELFN2))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ELFN2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ELFN2 antibody was raised against the N terminal of ELFN2

Purification: Affinity purified

Immunogen: ELFN2 antibody was raised using the N terminal of ELFN2 corresponding to a region with amino acids PVSHPTPYSTDAQREPDENSGFNPDEILSVEPPASSTTDASAGPAIKLHH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ELFN2 Blocking Peptide, catalog no. 33R-7422, is also available for use as a blocking control in assays to test for specificity of this ELFN2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ELFN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ELFN2

Target: ELFN2 (Extracellular Leucine-Rich Repeat and Fibronectin Type III Domain Containing 2 (ELFN2))

Alternative Name: ELFN2 (ELFN2 Products)

Synonyms: LRRC62 antibody, PPP1R29 antibody, dJ63G5.3 antibody, 6330514E13 antibody, AW048948 antibody, BC094219 antibody, Lrrc62 antibody, Ppp1r29 antibody, Elfn2-ps1 antibody, RGD1559693 antibody, extracellular leucine rich repeat and fibronectin type III domain containing 2 antibody, leucine rich repeat and fibronectin type III, extracellular 2 antibody, extracellular leucine-rich repeat and fibronectin type III domain containing 2 antibody, ELFN2 antibody, Elfn2 antibody

Background: ELFN2 is a single-pass membrane protein. It contains 1 fibronectin type-III domain and 5 LRR (leucine-rich) repeats. The exact function of ELFN2 remains unknown.

Molecular Weight: 90 kDa (MW of target protein)