TMEM176A antibody (Middle Region)

Catalog No. ABIN635509

Product Details anti-TMEM176A Antibody

Target: TMEM176A (Transmembrane Protein 176A (TMEM176A))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM176A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMEM176 A antibody was raised against the middle region of TMEM176

Purification: Affinity purified

Immunogen: TMEM176 A antibody was raised using the middle region of TMEM176 corresponding to a region with amino acids GYSYYNSACRISSSSDWNTPAPTQSPEEVRRLHLCTSFMDMLKALFRTLQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM176A Blocking Peptide, catalog no. 33R-3687, is also available for use as a blocking control in assays to test for specificity of this TMEM176A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM170 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM176A

Target: TMEM176A (Transmembrane Protein 176A (TMEM176A))

Alternative Name: TMEM176A (TMEM176A Products)

Synonyms: GS188 antibody, HCA112 antibody, 0610011I04Rik antibody, AU040201 antibody, AU041743 antibody, Keg2 antibody, 0610011i04rik antibody, RGD1310725 antibody, CL1 antibody, transmembrane protein 176A antibody, TMEM176A antibody, Tmem176a antibody

Background: TMEM161A may be involved in the development of dendritic cells.

Molecular Weight: 26 kDa (MW of target protein)