TMEM176A antibody (Middle Region)
-
- Target See all TMEM176A products
- TMEM176A (Transmembrane Protein 176A (TMEM176A))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TMEM176A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TMEM176 A antibody was raised against the middle region of TMEM176
- Purification
- Affinity purified
- Immunogen
- TMEM176 A antibody was raised using the middle region of TMEM176 corresponding to a region with amino acids GYSYYNSACRISSSSDWNTPAPTQSPEEVRRLHLCTSFMDMLKALFRTLQ
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TMEM176A Blocking Peptide, catalog no. 33R-3687, is also available for use as a blocking control in assays to test for specificity of this TMEM176A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM170 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TMEM176A (Transmembrane Protein 176A (TMEM176A))
- Alternative Name
- TMEM176A (TMEM176A Products)
- Synonyms
- GS188 antibody, HCA112 antibody, 0610011I04Rik antibody, AU040201 antibody, AU041743 antibody, Keg2 antibody, 0610011i04rik antibody, RGD1310725 antibody, CL1 antibody, transmembrane protein 176A antibody, TMEM176A antibody, Tmem176a antibody
- Background
- TMEM161A may be involved in the development of dendritic cells.
- Molecular Weight
- 26 kDa (MW of target protein)
-