UNC5A antibody
-
- Target See all UNC5A Antibodies
- UNC5A (Unc-5 Homolog A (UNC5A))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This UNC5A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- UNC5 A antibody was raised using a synthetic peptide corresponding to a region with amino acids VYCRKKEGLDSDVADSSILTSGFQPVSIKPSKADNPHLLTIQPDLSTTTT
- Top Product
- Discover our top product UNC5A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
UNC5A Blocking Peptide, catalog no. 33R-9915, is also available for use as a blocking control in assays to test for specificity of this UNC5A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UNC0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UNC5A (Unc-5 Homolog A (UNC5A))
- Alternative Name
- UNC5A (UNC5A Products)
- Synonyms
- zgc:175190 antibody, UNC5H1 antibody, Unc5h1 antibody, mKIAA1976 antibody, unc-5 netrin receptor A antibody, netrin receptor UNC5A antibody, UNC5A antibody, Tsp_02512 antibody, Tsp_13881 antibody, unc5a antibody, Unc5a antibody
- Background
- UNC5A belongs to a family of netrin-1 receptors thought to mediate the chemorepulsive effect of netrin-1 on specific axons.UNC5A belongs to a family of netrin-1 receptors thought to mediate the chemorepulsive effect of netrin-1 on specific axons.
- Molecular Weight
- 93 kDa (MW of target protein)
-