UNC5A antibody

Catalog No. ABIN635530

Product Details anti-UNC5A Antibody

Target: UNC5A (Unc-5 Homolog A (UNC5A))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UNC5A antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: UNC5 A antibody was raised using a synthetic peptide corresponding to a region with amino acids VYCRKKEGLDSDVADSSILTSGFQPVSIKPSKADNPHLLTIQPDLSTTTT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UNC5A Blocking Peptide, catalog no. 33R-9915, is also available for use as a blocking control in assays to test for specificity of this UNC5A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UNC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UNC5A

Target: UNC5A (Unc-5 Homolog A (UNC5A))

Alternative Name: UNC5A (UNC5A Products)

Synonyms: zgc:175190 antibody, UNC5H1 antibody, Unc5h1 antibody, mKIAA1976 antibody, unc-5 netrin receptor A antibody, netrin receptor UNC5A antibody, UNC5A antibody, Tsp_02512 antibody, Tsp_13881 antibody, unc5a antibody, Unc5a antibody

Background: UNC5A belongs to a family of netrin-1 receptors thought to mediate the chemorepulsive effect of netrin-1 on specific axons.UNC5A belongs to a family of netrin-1 receptors thought to mediate the chemorepulsive effect of netrin-1 on specific axons.

Molecular Weight: 93 kDa (MW of target protein)