SLC10A1 antibody

Catalog No. ABIN635619

The Rabbit Polyclonal anti-SLC10A1 antibody (ABIN635619) specifically detects SLC10A1 in WB. The antibody is reactive with Human samples.

Quick Overview for SLC10A1 antibody (ABIN635619)

Target: SLC10A1 (Solute Carrier Family 10 (Sodium/bile Acid Cotransporter Family), Member 1 (SLC10A1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC10A1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC10A1 Antibody

Purification: Affinity purified

Immunogen: SLC10 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC10A1 Blocking Peptide, (ABIN5616171), is also available for use as a blocking control in assays to test for specificity of this SLC10A1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC10A1

Target: SLC10A1 (Solute Carrier Family 10 (Sodium/bile Acid Cotransporter Family), Member 1 (SLC10A1))

Alternative Name: SLC10A1

Background: Sodium/bile acid cotransporters are integral membrane glycoproteins that participate in the enterohepatic circulation of bile acids.

Molecular Weight: 38 kDa (MW of target protein)