SLC10A1 antibody (C-Term)

Catalog No. ABIN3043337

Product Details anti-SLC10A1 Antibody

Target: SLC10A1 (Solute Carrier Family 10 (Sodium/bile Acid Cotransporter Family), Member 1 (SLC10A1))

Binding Specificity: AA 296-336, C-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC10A1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Sodium/bile acid cotransporter(SLC10A1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: EGLLFIIIFR CYLKIKPQKD QTKITYKAAA TEDATPAALE K

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Sodium/bile acid cotransporter(SLC10A1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: solute carrier family 10 (sodium/bile acid cotransporter family), member 1
Protein Name: Sodium/bile acid cotransporter

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of mouse SLC10A1 (296-336aa EGLLFIIIFRCYLKIKPQKDQTKITYKAAATEDATPAALEK), different from the related human sequence by eighteen amino acids, and from the related rat sequence by three amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for SLC10A1

Target: SLC10A1 (Solute Carrier Family 10 (Sodium/bile Acid Cotransporter Family), Member 1 (SLC10A1))

Alternative Name: SLC10A1 (SLC10A1 Products)

Synonyms: Ntcp antibody, NTCP antibody, Ntcp1 antibody, SBACT antibody, solute carrier family 10 (sodium/bile acid cotransporter family), member 1 antibody, solute carrier family 10 member 1 antibody, Slc10a1 antibody, SLC10A1 antibody

Background: Na+-taurocholate cotransporting polypeptide (NTCP), also known as SLC10A1 (Solute carrier family 10, member 1), is the major bile acid uptake system in human hepatocytes. NTCP and the ileal transporter ASBT (apical sodium-dependent bile acid transporter) are two sodium-dependent transporters critical for the enterohepatic circulation of bile acids. The hASBT gene is known to be activated by the glucocorticoid receptor (GR). Ho RH et al. indicates functionally important polymorphisms in NTCP exist and that the like lihood of being carriers of such polymorphisms is dependent on ethnicity.

Synonyms: Cell growth-inhibiting gene 29 protein antibody|Growth inhibiting protein 29 antibody|Na / bile acid cotransporter antibody|Na / taurocholate transport protein antibody|Na(+)/bile acid cotransporter antibody|Na(+)/taurocholate transport protein antibody|Na/taurocholate cotransporting polypeptide antibody|NTCP antibody|NTCP_HUMAN antibody|NTCP1 antibody| SLC10A1 antibody|Sodium/bile acid cotransporter antibody|Sodium/taurocholate cotransporter antibody|Sodium/taurocholate cotransporting polypeptide antibody|Solute carrier family 10 (sodium/bile acid cotransporter family) member 1 antibody|Solute carrier family 10 member 1 antibody

Gene ID: 20493

UniProt: O08705