SLC10A1 antibody

Catalog No. ABIN4951952

Product Details anti-SLC10A1 Antibody

Target: SLC10A1 (Solute Carrier Family 10 (Sodium/bile Acid Cotransporter Family), Member 1 (SLC10A1))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC10A1 antibody is un-conjugated

Application: Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunofluorescence (IF), Immunohistochemistry (Frozen Sections) (IHC (fro))

Purification: Antigen affinity

Immunogen: Amino acids EGLLFIIIFRCYLKIKPQKDQTKITYKAAATEDATPAALEK of mouse SLC10A1/NTCP were used as the immunogen for the NTCP antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the NTCP antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL,IHC (Frozen): 0.5-1 μg/mL,FACS: 1-3 μg/10^6 cells,IF (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the NTCP antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for SLC10A1

Target: SLC10A1 (Solute Carrier Family 10 (Sodium/bile Acid Cotransporter Family), Member 1 (SLC10A1))

Alternative Name: SLC10A1 / NTCP (SLC10A1 Products)

Synonyms: Ntcp antibody, NTCP antibody, Ntcp1 antibody, SBACT antibody, solute carrier family 10 (sodium/bile acid cotransporter family), member 1 antibody, solute carrier family 10 member 1 antibody, Slc10a1 antibody, SLC10A1 antibody

Background: Na+-taurocholate cotransporting polypeptide (NTCP), also known as SLC10A1 (Solute carrier family 10, member 1), is the major bile acid uptake system in human hepatocytes. NTCP and the ileal transporter ASBT (apical sodium-dependent bile acid transporter) are two sodium-dependent transporters critical for the enterohepatic circulation of bile acids. The hASBT gene is known to be activated by the glucocorticoid receptor (GR). Ho RH et al. indicates functionally important polymorphisms in NTCP exist and that the like lihood of being carriers of such polymorphisms is dependent on ethnicity.

UniProt: O08705