SYT9 antibody (Middle Region)
-
- Target See all SYT9 Antibodies
- SYT9 (Synaptotagmin IX (SYT9))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SYT9 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SYT9 antibody was raised against the middle region of SYT9
- Purification
- Affinity purified
- Immunogen
- SYT9 antibody was raised using the middle region of SYT9 corresponding to a region with amino acids PDFNIQQLQKQEQLTGIGRIKPELYKQRSLDNDDGRRSNSKACGKLNFIL
- Top Product
- Discover our top product SYT9 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SYT9 Blocking Peptide, catalog no. 33R-7008, is also available for use as a blocking control in assays to test for specificity of this SYT9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYT9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SYT9 (Synaptotagmin IX (SYT9))
- Alternative Name
- SYT9 (SYT9 Products)
- Synonyms
- Sytv antibody, zgc:91875 antibody, synaptotagmin IX antibody, synaptotagmin 9 antibody, synaptotagmin IXb antibody, Syt9 antibody, SYT9 antibody, syt9 antibody, syt9b antibody
- Background
- SYT9 may be involved in Ca2+-dependent exocytosis of secretory vesicles through Ca2+ and phospholipid binding to the C2 domain or may serve as Ca2+ sensors in the process of vesicular trafficking and exocytosis.
- Molecular Weight
- 56 kDa (MW of target protein)
-