ZDHHC18 antibody (Middle Region)
-
- Target See all ZDHHC18 Antibodies
- ZDHHC18 (Zinc Finger, DHHC-Type Containing 18 (ZDHHC18))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ZDHHC18 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ZDHHC18 antibody was raised against the middle region of ZDHHC18
- Purification
- Affinity purified
- Immunogen
- ZDHHC18 antibody was raised using the middle region of ZDHHC18 corresponding to a region with amino acids FSIWSILGLSGFHTYLVASNLTTNEDIKGSWSSKRGGEASVNPYSHKSII
- Top Product
- Discover our top product ZDHHC18 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ZDHHC18 Blocking Peptide, catalog no. 33R-3066, is also available for use as a blocking control in assays to test for specificity of this ZDHHC18 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZDHHC18 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ZDHHC18 (Zinc Finger, DHHC-Type Containing 18 (ZDHHC18))
- Alternative Name
- ZDHHC18 (ZDHHC18 Products)
- Synonyms
- fi45c03 antibody, wu:fi45c03 antibody, wu:fj48h10 antibody, zgc:55843 antibody, zdhhc18 antibody, zgc:153461 antibody, DHHC-18 antibody, DHHC18 antibody, zinc finger, DHHC-type containing 18b antibody, zinc finger, DHHC-type containing 18a antibody, zinc finger DHHC-type containing 18 antibody, zinc finger, DHHC domain containing 18 antibody, zinc finger, DHHC-type containing 18 antibody, zdhhc18b antibody, zdhhc18a antibody, ZDHHC18 antibody, Zdhhc18 antibody
- Background
- ZDHHC18 has palmitoyltransferase activity towards HRAS and LCK.
- Molecular Weight
- 42 kDa (MW of target protein)
-