EPSTI1 antibody

Catalog No. ABIN635669

Product Details anti-EPSTI1 Antibody

Target: EPSTI1 (Epithelial Stromal Interaction 1 (Breast) (EPSTI1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EPSTI1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: EPSTI1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RRLGGSQSETEVRQKQQLQLMQSKYKQKLKREESVRIKKEAEEAELQKMK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EPSTI1 Blocking Peptide, catalog no. 33R-8148, is also available for use as a blocking control in assays to test for specificity of this EPSTI1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPSTI1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EPSTI1

Target: EPSTI1 (Epithelial Stromal Interaction 1 (Breast) (EPSTI1))

Alternative Name: EPSTI1 (EPSTI1 Products)

Synonyms: EPSTI1 antibody, BRESI1 antibody, 2310046K10Rik antibody, 5033415K03Rik antibody, RGD1563207 antibody, epithelial stromal interaction 1 antibody, epithelial stromal interaction 1 (breast) antibody, EPSTI1 antibody, Epsti1 antibody

Background: EPSTI1 was up-regulated in breast carcinomas. The exact function of EPSTI1 is not known.

Molecular Weight: 47 kDa (MW of target protein)