SLC45A3 antibody (Middle Region)
-
- Target See all SLC45A3 products
- SLC45A3 (Solute Carrier Family 45, Member 3 (SLC45A3))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC45A3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SLC45 A3 antibody was raised against the middle region of SLC45 3
- Purification
- Affinity purified
- Immunogen
- SLC45 A3 antibody was raised using the middle region of SLC45 3 corresponding to a region with amino acids LFYTDFVGEGLYQGVPRAEPGTEARRHYDEGVRMGSLGLFLQCAISLVFS
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC45A3 Blocking Peptide, catalog no. 33R-4958, is also available for use as a blocking control in assays to test for specificity of this SLC45A3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC45A3 (Solute Carrier Family 45, Member 3 (SLC45A3))
- Alternative Name
- SLC45A3 (SLC45A3 Products)
- Synonyms
- MGC68967 antibody, zgc:162897 antibody, IPCA-2 antibody, IPCA-6 antibody, IPCA-8 antibody, IPCA6 antibody, PCANAP2 antibody, PCANAP6 antibody, PCANAP8 antibody, PRST antibody, 2210413P12Rik antibody, AU023994 antibody, AU043764 antibody, Pcanap6 antibody, RGD1309764 antibody, solute carrier family 45 member 3 L homeolog antibody, solute carrier family 45 member 3 antibody, solute carrier family 45, member 3 antibody, slc45a3.L antibody, SLC45A3 antibody, slc45a3 antibody, Slc45a3 antibody
- Background
- SLC45A3 is a multi-pass membrane protein. It belongs to the glycoside-pentoside-hexuronide (GPH) cation symporter transporter family. It is a marker for prostate cells. It may be used, in case of prostate cancers, as a target antigen for protate carcinomas-directed cytotoxic T-cell lymphocytes.
- Molecular Weight
- 59 kDa (MW of target protein)
-