B3GALT1 antibody (N-Term)
-
- Target See all B3GALT1 Antibodies
- B3GALT1 (UDP-Gal:betaGlcNAc beta 1,3-Galactosyltransferase, Polypeptide 1 (B3GALT1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This B3GALT1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- B3 GALT1 antibody was raised against the N terminal of B3 ALT1
- Purification
- Affinity purified
- Immunogen
- B3 GALT1 antibody was raised using the N terminal of B3 ALT1 corresponding to a region with amino acids MASKVSCLYVLTVVCWASALWYLSITRPTSSYTGSKPFSHLTVARKNFTF
- Top Product
- Discover our top product B3GALT1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
B3GALT1 Blocking Peptide, catalog no. 33R-5750, is also available for use as a blocking control in assays to test for specificity of this B3GALT1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 ALT1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- B3GALT1 (UDP-Gal:betaGlcNAc beta 1,3-Galactosyltransferase, Polypeptide 1 (B3GALT1))
- Alternative Name
- B3GALT1 (B3GALT1 Products)
- Synonyms
- beta3Gal-T1 antibody, Beta3GalT1 antibody, beta-1,3-galactosyltransferase 1 antibody, UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 1 antibody, Beta-1,3-galactosyltransferase 1 antibody, B3GALT1 antibody, B3galt1 antibody
- Background
- B3GALT1 is a member of the beta-1,3-galactosyltransferase (beta3GalT) family. This family are type II membrane-bound glycoproteins with diverse enzymatic functions using different donor substrates (UDP-galactose and UDP-N-acetylglucosamine) and different acceptor sugars (N-acetylglucosamine, galactose, N-acetylgalactosamine). The beta3GalT genes are distantly related to the Drosophila Brainiac gene and have the protein coding sequence contained in a single exon.
- Molecular Weight
- 38 kDa (MW of target protein)
-