TSPAN31 antibody (Middle Region)
-
- Target See all TSPAN31 Antibodies
- TSPAN31 (Tetraspanin 31 (TSPAN31))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TSPAN31 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Tetraspanin 31 antibody was raised against the middle region of TSPAN31
- Purification
- Affinity purified
- Immunogen
- Tetraspanin 31 antibody was raised using the middle region of TSPAN31 corresponding to a region with amino acids CTAICKSQSPTCQMCGEKFLKHSDEALKILGGVGLFFSFTEILGVWLAMR
- Top Product
- Discover our top product TSPAN31 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Tetraspanin 31 Blocking Peptide, catalog no. 33R-1819, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 31 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN31 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TSPAN31 (Tetraspanin 31 (TSPAN31))
- Alternative Name
- Tetraspanin 31 (TSPAN31 Products)
- Synonyms
- SAS antibody, 2700085A14Rik antibody, AW742554 antibody, Sas antibody, tspan31 antibody, zgc:56710 antibody, sas antibody, tetraspanin 31 antibody, tetraspanin 31 L homeolog antibody, tetraspanin 31 S homeolog antibody, TSPAN31 antibody, Tspan31 antibody, tspan31 antibody, tspan31.L antibody, tspan31.S antibody
- Background
- TSPAN31 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is thought to be involved in growth-related cellular processes. This gene is associated with tumorigenesis and osteosarcoma.
- Molecular Weight
- 23 kDa (MW of target protein)
-