XYLT2 antibody (C-Term)
-
- Target See all XYLT2 Antibodies
- XYLT2 (Xylosyltransferase II (XYLT2))
-
Binding Specificity
- C-Term
-
Reactivity
- Mouse, Human, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This XYLT2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- XYLT2 antibody was raised against the C terminal of XYLT2
- Purification
- Affinity purified
- Immunogen
- XYLT2 antibody was raised using the C terminal of XYLT2 corresponding to a region with amino acids LRPGPWTVRLLQFWEPLGETRFLVLPLTFNRKLPLRKDDASWLHAGPPHN
- Top Product
- Discover our top product XYLT2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
XYLT2 Blocking Peptide, catalog no. 33R-5377, is also available for use as a blocking control in assays to test for specificity of this XYLT2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XYLT2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- XYLT2 (Xylosyltransferase II (XYLT2))
- Alternative Name
- XYLT2 (XYLT2 Products)
- Synonyms
- MGC89331 antibody, PXYLT2 antibody, XT-II antibody, XT2 antibody, xylT-II antibody, xt-II antibody, E030002B02Rik antibody, xylt-II antibody, xylosyltransferase II antibody, xylosyltransferase 2 antibody, xylt2 antibody, XYLT2 antibody, Xylt2 antibody
- Background
- XYLT2 is an isoform of xylosyltransferase, which belongs to a family of glycosyltransferases. This enzyme transfers xylose from UDP-xylose to specific serine residues of the core protein and initiates the biosynthesis of glycosaminoglycan chains in proteoglycans including chondroitin sulfate, heparan sulfate, heparin and dermatan sulfate. The enzyme activity, which is increased in scleroderma patients, is a diagnostic marker for the determination of sclerotic activity in systemic sclerosis.
- Molecular Weight
- 97 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-