ChT antibody
-
- Target See all ChT Antibodies
- ChT (High Affinity Choline Transporter (ChT))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ChT antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SLC5 A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids DDNGIYNQKFPFKTLAMVTSFLTNICISYLAKYLFESGTLPPKLDVFDAV
- Top Product
- Discover our top product ChT Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC5A7 Blocking Peptide, catalog no. 33R-1884, is also available for use as a blocking control in assays to test for specificity of this SLC5A7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ChT (High Affinity Choline Transporter (ChT))
- Alternative Name
- SLC5A7 (ChT Products)
- Synonyms
- CHT antibody, CHT1 antibody, HMN7A antibody, hCHT antibody, Cht1 antibody, solute carrier family 5 member 7 antibody, solute carrier family 5 (choline transporter), member 7 antibody, SLC5A7 antibody, Slc5a7 antibody
- Background
- Choline is a direct precursor of acetylcholine (ACh), a neurotransmitter of the central and peripheral nervous system that regulates a variety of autonomic, cognitive, and motor functions. SLC5A7 is a Na(+)- and Cl(-)- dependent high-affinity transporter that mediates the uptake of choline for acetylcholine synthesis in cholinergic neurons.
- Molecular Weight
- 63 kDa (MW of target protein)
-