CHST1 antibody
-
- Target See all CHST1 Antibodies
- CHST1 (Carbohydrate (Keratan Sulfate Gal-6) Sulfotransferase 1 (CHST1))
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CHST1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- CHST1 antibody was raised using a synthetic peptide corresponding to a region with amino acids YRLWRLWYGTGRKPYNLDVTQLTTVCEDFSNSVSTGLMRPPWLKGKYMLV
- Top Product
- Discover our top product CHST1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CHST1 Blocking Peptide, catalog no. 33R-10227, is also available for use as a blocking control in assays to test for specificity of this CHST1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHST1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CHST1 (Carbohydrate (Keratan Sulfate Gal-6) Sulfotransferase 1 (CHST1))
- Alternative Name
- CHST1 (CHST1 Products)
- Synonyms
- C6ST antibody, GST-1 antibody, KS6ST antibody, KSGal6ST antibody, KSST antibody, sulfo1 antibody, 2610008E20Rik antibody, AW125896 antibody, Gst1 antibody, KSGAL6ST antibody, carbohydrate sulfotransferase 1 antibody, carbohydrate (keratan sulfate Gal-6) sulfotransferase 1 antibody, CHST1 antibody, Chst1 antibody
- Background
- CHST1 catalyzes the transfer of sulfate to position 6 of galactose (Gal) residues of keratan. It has a preference for sulfating keratan sulfate, but it also transfers sulfate to the unsulfated polymer.
- Molecular Weight
- 47 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-