CYP4F12 antibody (Middle Region)
-
- Target See all CYP4F12 Antibodies
- CYP4F12 (Cytochrome P450, Family 4, Subfamily F, Polypeptide 12 (CYP4F12))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CYP4F12 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CYP4 F12 antibody was raised against the middle region of CYP4 12
- Purification
- Affinity purified
- Immunogen
- CYP4 F12 antibody was raised using the middle region of CYP4 12 corresponding to a region with amino acids DGRRFHRACRLVHDFTDAVIRERRRTLPTQGIDDFFKDKAKSKTLDFIDV
- Top Product
- Discover our top product CYP4F12 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CYP4F12 Blocking Peptide, catalog no. 33R-1964, is also available for use as a blocking control in assays to test for specificity of this CYP4F12 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 12 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CYP4F12 (Cytochrome P450, Family 4, Subfamily F, Polypeptide 12 (CYP4F12))
- Alternative Name
- CYP4F12 (CYP4F12 Products)
- Synonyms
- F22329_1 antibody, DKFZp469H0334 antibody, cytochrome P450 family 4 subfamily F member 12 antibody, cytochrome P450, family 4, subfamily F, polypeptide 12 antibody, cytochrome P450 4F12 antibody, CYP4F12 antibody, CpipJ_CPIJ016853 antibody, MCYG_08150 antibody
- Background
- CYP4F12 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. Tt likely localizes to the endoplasmic reticulum. When expressed in yeast the enzyme is capable of oxdizing arachidonic acid, however, its physiological function has not been determined.
- Molecular Weight
- 60 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-