SLC22A15 antibody (Middle Region)
-
- Target See all SLC22A15 Antibodies
- SLC22A15 (Solute Carrier Family 22, Member 15 (SLC22A15))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC22A15 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SLC22 A15 antibody was raised against the middle region of SLC22 15
- Purification
- Affinity purified
- Immunogen
- SLC22 A15 antibody was raised using the middle region of SLC22 15 corresponding to a region with amino acids NQKWFGRKRTLSAFLCLGGLACLIVMFLPEKKDTGVFAVVNSHSLSLLGK
- Top Product
- Discover our top product SLC22A15 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC22A15 Blocking Peptide, catalog no. 33R-6840, is also available for use as a blocking control in assays to test for specificity of this SLC22A15 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 15 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC22A15 (Solute Carrier Family 22, Member 15 (SLC22A15))
- Alternative Name
- SLC22A15 (SLC22A15 Products)
- Synonyms
- FLIPT1 antibody, PRO34686 antibody, 2610034P21Rik antibody, 4930477M19 antibody, A530052I06Rik antibody, BB219042 antibody, solute carrier family 22 member 15 antibody, solute carrier family 22 (organic anion/cation transporter), member 15 antibody, solute carrier family 22, member 15 antibody, SLC22A15 antibody, Slc22a15 antibody
- Background
- Organic ion transporters, such as SLC22A15, transport various medically and physiologically important compounds, including pharmaceuticals, toxins, hormones, neurotransmitters, and cellular metabolites.
- Molecular Weight
- 59 kDa (MW of target protein)
-