DLK1 antibody
-
- Target See all DLK1 Antibodies
- DLK1 (delta-Like 1 Homolog (Drosophila) (DLK1))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DLK1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- DLK1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLT
- Top Product
- Discover our top product DLK1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DLK1 Blocking Peptide, catalog no. 33R-8692, is also available for use as a blocking control in assays to test for specificity of this DLK1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLK1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DLK1 (delta-Like 1 Homolog (Drosophila) (DLK1))
- Alternative Name
- DLK1 (DLK1 Products)
- Synonyms
- DELTA1 antibody, DL1 antibody, Delta antibody, DLK antibody, DLK-1 antibody, Delta1 antibody, FA1 antibody, PREF1 antibody, Pref-1 antibody, ZOG antibody, pG2 antibody, AW742678 antibody, DlkI antibody, Ly107 antibody, Peg9 antibody, SCP1 antibody, pref-1 antibody, Zog antibody, delta like canonical Notch ligand 1 antibody, delta like non-canonical Notch ligand 1 antibody, delta-like 1 homolog (Drosophila) antibody, delta-like 1 (Drosophila) antibody, DLL1 antibody, DLK1 antibody, Dll1 antibody, Dlk1 antibody
- Background
- DLK1 may have a role in neuroendocrine differentiation.
- Molecular Weight
- 41 kDa (MW of target protein)
-