TEX264 antibody (Middle Region)

Catalog No. ABIN635856

Product Details anti-TEX264 Antibody

Target: TEX264 (Testis Expressed 264 (TEX264))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TEX264 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TEX264 antibody was raised against the middle region of TEX264

Purification: Affinity purified

Immunogen: TEX264 antibody was raised using the middle region of TEX264 corresponding to a region with amino acids GWDDGDTRSEHSYSESGASGSSFEELDLEGEGPLGESRLDPGTEPLGTTK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TEX264 Blocking Peptide, catalog no. 33R-3666, is also available for use as a blocking control in assays to test for specificity of this TEX264 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TEX264 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TEX264

Target: TEX264 (Testis Expressed 264 (TEX264))

Alternative Name: TEX264 (TEX264 Products)

Synonyms: ZSIG11 antibody, TEG-264 antibody, testis expressed 264 antibody, testis expressed gene 264 antibody, TEX264 antibody, Tex264 antibody

Background: The specific function of TEX264 is not yet known.

Molecular Weight: 34 kDa (MW of target protein)