ACPT antibody (Middle Region)
-
- Target See all ACPT Antibodies
- ACPT (Acid Phosphatase, Testicular (ACPT))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ACPT antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ACPT antibody was raised against the middle region of ACPT
- Purification
- Affinity purified
- Immunogen
- ACPT antibody was raised using the middle region of ACPT corresponding to a region with amino acids TLLALQGALGLYDGHTPPYAACLGFEFRKHLGNPAKDGGNVTVSLFYRND
- Top Product
- Discover our top product ACPT Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ACPT Blocking Peptide, catalog no. 33R-9175, is also available for use as a blocking control in assays to test for specificity of this ACPT antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACPT antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACPT (Acid Phosphatase, Testicular (ACPT))
- Alternative Name
- ACPT (ACPT Products)
- Synonyms
- EG546967 antibody, Gm1432 antibody, acid phosphatase 4 antibody, ACP4 antibody, Acp4 antibody
- Background
- Acid phosphatases are enzymes capable of hydrolyzing orthophosphoric acid esters in an acid medium. This gene is up-regulated by androgens and is down-regulated by estrogens in the prostate cancer cell line. This gene exhibits a lower level of expression in testicular cancer tissues than in normal tissues. ACPT has structural similarity to prostatic and lysosomal acid phosphatases.
- Molecular Weight
- 43 kDa (MW of target protein)
-