RNF43 antibody (Middle Region)
-
- Target See all RNF43 Antibodies
- RNF43 (Ring Finger Protein 43 (RNF43))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RNF43 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RNF43 antibody was raised against the middle region of RNF43
- Purification
- Affinity purified
- Immunogen
- RNF43 antibody was raised using the middle region of RNF43 corresponding to a region with amino acids DFDPLVYCSPKGDPQRVDMQPSVTSRPRSLDSVVPTGETQVSSHVHYHRH
- Top Product
- Discover our top product RNF43 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RNF43 Blocking Peptide, catalog no. 33R-1926, is also available for use as a blocking control in assays to test for specificity of this RNF43 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF43 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RNF43 (Ring Finger Protein 43 (RNF43))
- Alternative Name
- RNF43 (RNF43 Products)
- Synonyms
- RNF124 antibody, URCC antibody, 4732452J19Rik antibody, RGD1305204 antibody, ring finger protein 43 antibody, RNF43 antibody, Rnf43 antibody
- Background
- RNF43 is a HAP95 (AKAP8L) binding ubiquitin ligase that promotes cell growth and is upregulated in colon cancer.
- Molecular Weight
- 86 kDa (MW of target protein)
- Pathways
- WNT Signaling
-