ALG6 antibody
-
- Target See all ALG6 Antibodies
- ALG6 (Asparagine-Linked Glycosylation 6, alpha-1,3-Glucosyltransferase Homolog (ALG6))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ALG6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ALG6 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLTAYHSLLCAYVAKFINPDWIALHTSRGYESQAHKLFMRTTVLIADLLI
- Top Product
- Discover our top product ALG6 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ALG6 Blocking Peptide, catalog no. 33R-7210, is also available for use as a blocking control in assays to test for specificity of this ALG6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALG6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ALG6 (Asparagine-Linked Glycosylation 6, alpha-1,3-Glucosyltransferase Homolog (ALG6))
- Alternative Name
- ALG6 (ALG6 Products)
- Synonyms
- CG5091 antibody, Dalg6 antibody, Dmel\\CG5091 antibody, alg6 antibody, zgc:100813 antibody, CDG1C antibody, E230028F23Rik antibody, garnysstan antibody, asparagine-linked glycosylation 6 (alpha-1,3,-glucosyltransferase) antibody, ALG6, alpha-1,3-glucosyltransferase antibody, ALG6, alpha-1,3-glucosyltransferase S homeolog antibody, gny antibody, alg6 antibody, ALG6 antibody, alg6.S antibody, Alg6 antibody
- Background
- ALG6 is a member of the ALG6/ALG8 glucosyltransferase family. It catalyzes the addition of the first glucose residue to the growing lipid-linked oligosaccharide precursor of N-linked glycosylation. Mutations in this gene encoding ALG6 are associated with congenital disorders of glycosylation type Ic.
- Molecular Weight
- 58 kDa (MW of target protein)
-