Nurim antibody
-
- Target See all Nurim (NRM) Antibodies
- Nurim (NRM) (Nurim (Nuclear Envelope Membrane Protein) (NRM))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Nurim antibody is un-conjugated
- Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- Nurim antibody was raised using a synthetic peptide corresponding to a region with amino acids MAPALLLIPAALASFILAFGTGVEFVRFTSLRPLLGGIPESGGPDARQGW
- Top Product
- Discover our top product NRM Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Nurim Blocking Peptide, catalog no. 33R-5708, is also available for use as a blocking control in assays to test for specificity of this Nurim antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NRM antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Nurim (NRM) (Nurim (Nuclear Envelope Membrane Protein) (NRM))
- Alternative Name
- Nurim (NRM Products)
- Synonyms
- NRM29 antibody, 2610307M02Rik antibody, AI429796 antibody, si:dkey-263h23.2 antibody, nurim antibody, nurim (nuclear envelope membrane protein) antibody, nurim L homeolog antibody, NRM antibody, Nrm antibody, nrm.L antibody, nrm antibody
- Background
- The function of Nurim protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 29 kDa (MW of target protein)
-