B3GALT6 antibody (N-Term)
-
- Target See all B3GALT6 Antibodies
- B3GALT6 (UDP-Gal:betaGal beta 1,3-Galactosyltransferase Polypeptide 6 (B3GALT6))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This B3GALT6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- B3 GALT6 antibody was raised against the N terminal of B3 ALT6
- Purification
- Affinity purified
- Immunogen
- B3 GALT6 antibody was raised using the N terminal of B3 ALT6 corresponding to a region with amino acids EREQARHGDLLLLPALRDAYENLTAKVLAMLAWLDEHVAFEFVLKADDDS
- Top Product
- Discover our top product B3GALT6 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
B3GALT6 Blocking Peptide, catalog no. 33R-2691, is also available for use as a blocking control in assays to test for specificity of this B3GALT6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 ALT6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- B3GALT6 (UDP-Gal:betaGal beta 1,3-Galactosyltransferase Polypeptide 6 (B3GALT6))
- Alternative Name
- B3GALT6 (B3GALT6 Products)
- Synonyms
- B3GALT6 antibody, MGC69183 antibody, Dyak\\GE22868 antibody, GE22868 antibody, beta3galt6 antibody, dyak_GLEANR_663 antibody, Dere\\GG10628 antibody, GG10628 antibody, dere_GLEANR_10535 antibody, Dper\\GL21178 antibody, GL21178 antibody, dper_GLEANR_3106 antibody, Dsec\\GM20673 antibody, GM20673 antibody, dsec_GLEANR_3487 antibody, Dpse\\GA28758 antibody, GA28758 antibody, dpse_GLEANR_8882 antibody, EDSP2 antibody, SEMDJL1 antibody, beta3GalT6 antibody, BB129894 antibody, GalTII antibody, beta-1,3-galactosyltransferase 6 antibody, Beta-1,3-galactosyltransferase 6 antibody, UDP-Gal:betaGal beta 1,3-galactosyltransferase polypeptide 6 antibody, UDP-Gal:betaGal beta 1,3-galactosyltransferase, polypeptide 6 antibody, B3GALT6 antibody, b3galt6 antibody, CpipJ_CPIJ010407 antibody, Dyak\beta3galt6 antibody, Dere\beta3galt6 antibody, Dper\beta3galt6 antibody, Dsec\beta3galt6 antibody, Dpse\beta3galt6 antibody, LOC100285906 antibody, B3galt6 antibody
- Background
- B3GALT6 (Beta-1,3-galactosyltransferase) transfers galactose from UDP-galactose to substrates with a terminal beta-linked galactose residue. It has a preference for galactose-beta-1,4-xylose that is found in the linker region of glycosaminoglycans, such as heparan sulfate and chondroitin sulfate. It has no activity towards substrates with terminal glucosamine or galactosamine residues.
- Molecular Weight
- 37 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-