ACE2 antibody

Catalog No. ABIN636042

Product Details anti-ACE2 Antibody

Target: ACE2 (Angiotensin I Converting Enzyme 2 (ACE2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACE2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: ACE2 antibody was raised using a synthetic peptide corresponding to a region with amino acids FVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDNSLEFLGIQPTLGP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACE2 Blocking Peptide, catalog no. 33R-3121, is also available for use as a blocking control in assays to test for specificity of this ACE2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACE2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACE2

Target: ACE2 (Angiotensin I Converting Enzyme 2 (ACE2))

Alternative Name: ACE2 (ACE2 Products)

Synonyms: ACE1 antibody, CD143 antibody, DCP antibody, DCP1 antibody, ICH antibody, MVCD3 antibody, ACEH antibody, 2010305L05Rik antibody, zgc:92514 antibody, angiotensin I converting enzyme antibody, angiotensin I converting enzyme 2 antibody, angiotensin I converting enzyme (peptidyl-dipeptidase A) 2 antibody, ACE antibody, ACE2 antibody, Ace2 antibody, ace2 antibody

Background: ACE2 belongs to the angiotensin-converting enzyme family of dipeptidyl carboxydipeptidases and has considerable homology to human angiotensin 1 converting enzyme. This secreted protein catalyzes the cleavage of angiotensin I into angiotensin 1-9, and angiotensin II into the vasodilator angiotensin 1-7. The organ- and cell-specific expression of this geneuggests that it may play a role in the regulation of cardiovascular and renal function, as well as fertility. In addition, the encoded protein is a functional receptor for the spike glycoprotein of the human coronaviruses SARS and HCoV-NL63.

Molecular Weight: 89 kDa (MW of target protein)

Pathways: ACE Inhibitor Pathway, Peptide Hormone Metabolism, Regulation of Systemic Arterial Blood Pressure by Hormones, Feeding Behaviour