CYP4B1 antibody (N-Term)

Catalog No. ABIN636076

Product Details anti-CYP4B1 Antibody

Target: CYP4B1 (Cytochrome P450, Family 4, Subfamily B, Polypeptide 1 (CYP4B1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CYP4B1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CYP4 B1 antibody was raised against the N terminal of CYP4 1

Purification: Affinity purified

Immunogen: CYP4 B1 antibody was raised using the N terminal of CYP4 1 corresponding to a region with amino acids SWAHQFPYAHPLWFGQFIGFLNIYEPDYAKAVYSRGDPKAPDVYDFFLQW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CYP4B1 Blocking Peptide, catalog no. 33R-8937, is also available for use as a blocking control in assays to test for specificity of this CYP4B1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CYP4B1

Target: CYP4B1 (Cytochrome P450, Family 4, Subfamily B, Polypeptide 1 (CYP4B1))

Alternative Name: CYP4B1 (CYP4B1 Products)

Synonyms: CYPIVB1 antibody, P-450HP antibody, cytochrome P450, family 4, subfamily B, polypeptide 1 antibody, CYP4B1-like isozyme short form antibody, cytochrome P450, family 4, subfamily B, polypeptide 1 L homeolog antibody, cytochrome P450 family 4 subfamily B member 1 antibody, cytochrome P450, family 4, subfamily b, polypeptide 1 antibody, cytochrome P450 family 4 subfamily B member 1 L homeolog antibody, CYP4B1 antibody, cyp4b1.L antibody, cyp4b1 antibody, Cyp4b1 antibody, cyp4b1.2.L antibody

Background: CYP4B1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. In rodents, the homologous protein has been shown to metabolize certain carcinogens, however, the specific function of the human protein has not been determined.

Molecular Weight: 59 kDa (MW of target protein)