Tissue factor antibody (AA 45-154)

Catalog No. ABIN947845

Product Details anti-Tissue factor Antibody

Target: Tissue factor (F3) (Coagulation Factor III (thromboplastin, Tissue Factor) (F3))

Binding Specificity: AA 45-154

Reactivity: Human

Host: Mouse

Clonality: Monoclonal

Conjugate: This Tissue factor antibody is un-conjugated

Application: Western Blotting (WB), ELISA

Purpose: Mouse monoclonal antibody raised against a partial recombinant F3.

Cross-Reactivity: Human

Immunogen:

immunogen: F3 (AAH11029, 45 a.a. ~ 154 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: TWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTK

Clone: 4G4

Isotype: IgG2a kappa

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions: For Research Use only

Handling

Format: Liquid

Buffer: In ascites fluid

Handling Advice: Aliquot to avoid repeated freezing and thawing.

Storage: -20 °C

Storage Comment: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

References for anti-Tissue factor antibody (ABIN947845)

Cugno, Marzano, Lorini, Carbonelli, Tedeschi: "Enhanced tissue factor expression by blood eosinophils from patients with hypereosinophilia: a possible link with thrombosis." in: PLoS ONE, Vol. 9, Issue 11, pp. e111862, (2014) (PubMed).

Target Details for Tissue factor

Target: Tissue factor (F3) (Coagulation Factor III (thromboplastin, Tissue Factor) (F3))

Alternative Name: F3 (F3 Products)

Synonyms: CD142 antibody, TF antibody, TFA antibody, PRO1557 antibody, PRO2086 antibody, TFQTL1 antibody, f3 antibody, AA409063 antibody, Cf-3 antibody, Cf3 antibody, tf antibody, zgc:112151 antibody, coagulation factor III, tissue factor antibody, transferrin antibody, coagulation factor IIIa antibody, coagulation factor III antibody, tissue factor antibody, coagulation factor IIIb antibody, coagulation factor III (thromboplastin, tissue factor) S homeolog antibody, F3 antibody, TF antibody, f3a antibody, tf antibody, f3b antibody, f3.S antibody

Background: Full Gene Name: coagulation factor III (thromboplastin, tissue factor)
Synonyms: CD142,TF,TFA

Gene ID: 2152

Pathways: Positive Regulation of Endopeptidase Activity, Smooth Muscle Cell Migration, Platelet-derived growth Factor Receptor Signaling