anti-Human C9 antibody for Immunohistochemistry

Recommended C9 Antibody (supplied by: Log in to see )

Antigen
Complement Component C9 (C9) Antibodies
  • LOC100037951
  • LOC100136130
  • complement component C9
  • complement component 9
  • LOC100037951
  • LOC100136130
  • C9
  • c9
Reactivity
Human
86
17
14
2
Host
Rabbit
56
26
5
2
1
Clonality
Polyclonal
Conjugate
This C9 antibody is un-conjugated
4
4
4
3
3
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
60
42
38
23
14
7
6
3
3
1
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4299957
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
8.897652 ABIN316351 ELISA IF IHC WB Mouse IgG1 kappa Log in to see C9 53
8.897652 ABIN3029695 IHC ELISA WB Rabbit Ig Fraction AA 191-220 Log in to see Polyclonal
1 ABIN1876823 IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN4299956 FACS IA IHC IHC (fro) IHC (p) WB Mouse IgG1 Log in to see X197 1
1 ABIN4299958 IHC IHC (p) WB Rabbit IgG Center Log in to see Polyclonal
1 ABIN2216218 IHC ELISA WB Rabbit IgG AA 191-220, Center, Internal Region Log in to see Polyclonal
1 ABIN2216212 IHC ELISA WB APC Rabbit IgG AA 191-220, Center, Internal Region Log in to see Polyclonal
1 ABIN2216214 IHC ELISA WB FITC Rabbit IgG AA 191-220, Center, Internal Region Log in to see Polyclonal
1 ABIN2216215 IHC ELISA WB HRP Rabbit IgG AA 191-220, Center, Internal Region Log in to see Polyclonal
1 ABIN2216216 IHC ELISA WB PE Rabbit IgG AA 191-220, Center, Internal Region Log in to see Polyclonal
1 ABIN2216209 IHC WB Mouse IgG1 kappa Log in to see 64E9
1 ABIN2216213 IHC ELISA WB Biotin Rabbit IgG AA 191-220, Center, Internal Region Log in to see Polyclonal
1 ABIN2216217 IHC ELISA WB Alkaline Phosphatase (AP) Rabbit IgG AA 191-220, Center, Internal Region Log in to see Polyclonal
1 ABIN1866979 ICC IHC IP WB Rabbit IgG AA 22-265 Log in to see Polyclonal
1 ABIN2216208 IC IF IHC WB Rabbit AA 184-411 Log in to see Polyclonal
1 ABIN2471668 IHC WB Mouse IgG1 kappa Log in to see 6-40E-010
1 ABIN4264710 ELISA IHC WB Alexa Fluor 647 Mouse IgG1 kappa Log in to see C9 53
1 ABIN4264714 ELISA IHC FITC Mouse IgG1 kappa Log in to see C9 53
1 ABIN4264715 ELISA IHC WB DyLight 680 Mouse IgG1 kappa Log in to see C9 53
1 ABIN4264719 ELISA IHC WB DyLight 550 Mouse IgG1 kappa Log in to see C9 53

General

Antigen Complement Component C9 (C9) Antibodies
Reactivity Human
(86), (17), (14), (2)
Host Rabbit
(56), (26), (5), (2), (1)
Clonality
Polyclonal
Conjugate This C9 antibody is un-conjugated
(4), (4), (4), (3), (3), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(60), (42), (38), (23), (14), (7), (6), (3), (3), (1), (1), (1), (1), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-C9 Antibody

Target Details C9 Application Details Handling ProductDetails: References for anti-C9 antibody (ABIN4299957) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:CLGYHLDVSLAFSEISVGAEFNKDDCVKRGEGRAVNITSENLIDDVVSLIRGGTRKYAFELKEKLLRGTVIDVTDFVNWASSINDAPVLISQKLSPIYNLVPVKMKNAHLKKQNLERAIEDYINEFSVRKCHTCQNGGTVILMDGK
Isotype IgG

Target Details C9

Product Details anti-C9 Antibody Application Details Handling ProductDetails: References for anti-C9 antibody (ABIN4299957) Images back to top
Antigen
Alternative Name Complement Component C9 (C9 Antibody Abstract)
Background Gene Symbol: C9
Gene ID 735
Pathways Complement System

Application Details

Product Details anti-C9 Antibody Target Details C9 Handling ProductDetails: References for anti-C9 antibody (ABIN4299957) Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:2500 - 1:5000, ImmunofluorescenceFor IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-C9 Antibody Target Details C9 Application Details ProductDetails: References for anti-C9 antibody (ABIN4299957) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

ProductDetails: References for anti-C9 antibody (ABIN4299957)

Product Details anti-C9 Antibody Target Details C9 Application Details Handling Images back to top
Product cited in:

Neiman, Fredolini, Johansson, Lehtiö, Nygren, Uhlén, Nilsson, Schwenk: "Selectivity analysis of single binder assays used in plasma protein profiling." in: Proteomics, Vol. 13, Issue 23-24, pp. 3406-10, 2013

Images

Product Details anti-C9 Antibody Target Details C9 Application Details Handling ProductDetails: References for anti-C9 antibody (ABIN4299957) back to top
Supplier Images
Immunofluorescence (IF) image for anti-Complement Component C9 (C9) antibody (ABIN4299957) Immunofluorescence: Complement Component C9 Antibody [NBP1-87440] - Staining of human...
Immunohistochemistry (IHC) image for anti-Complement Component C9 (C9) antibody (ABIN4299957) Immunohistochemistry: Complement Component C9 Antibody [NBP1-87440] - Staining of hum...