You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Mouse (Murine) GNAQ antibody for Western Blotting

Recommended GNAQ Antibody (supplied by: Log in to see )

Guanine Nucleotide Binding Protein (G Protein), Q Polypeptide (GNAQ) Antibodies
  • si:ch73-270f14.2
  • CMC1
  • G-ALPHA-q
  • GAQ
  • SWS
  • Galphaq
  • Gnaq
  • g-alpha-q
  • gaq
  • gnaqb
  • 1110005L02Rik
  • 6230401I02Rik
  • AA408290
  • AW060788
  • Dsk1
  • Dsk10
  • Gq
  • GqI
  • guanine nucleotide binding protein (G protein), q polypeptide
  • guanine nucleotide binding protein, alpha q polypeptide
  • gnaq
  • GNAQ
  • Gnaq
  • gnaq-b
AA 102-138, N-Term
Human, Mouse (Murine), Rat (Rattus)
This GNAQ antibody is un-conjugated
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN3043833
$ 240.00
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
3.0923712 ABIN968914 IF WB Mouse IgG1 AA 22-31 Log in to see 10-GAQ 3
3.0923712 ABIN968915 IF WB Mouse IgG1 AA 22-31 Log in to see 10-GAQ 3
3.0923712 ABIN4315225 ELISA WB Goat Log in to see Polyclonal 1
3.0923712 ABIN2855848 IHC (p) WB Rabbit IgG Center Log in to see Polyclonal
3.0923712 ABIN2464519 ELISA WB Goat Internal Region Log in to see Polyclonal
3.0923712 ABIN615969 EIA IHC (p) WB Goat AA 162-175, Internal Region Log in to see Polyclonal
3.0923712 ABIN2562862 ELISA WB Goat IgG AA 162-175 Log in to see Polyclonal
3.0923712 ABIN441968 IHC IHC (p) WB Rabbit IgG Center Log in to see Polyclonal
1 ABIN2785811 WB Rabbit N-Term Log in to see Polyclonal 1
1 ABIN2785812 WB Rabbit Middle Region Log in to see Polyclonal
1 ABIN768987 IHC (p) WB Rabbit IgG AA 71-120 Log in to see Polyclonal
1 ABIN799135 WB Rabbit AA 147-196 Log in to see Polyclonal
1 ABIN763181 IF (p) IHC (p) WB Rabbit IgG AA 50-100 Log in to see Polyclonal
1 ABIN1734841 IHC (p) ELISA WB Goat Internal Region Log in to see Polyclonal
1 ABIN763190 IHC (p) WB HRP Rabbit IgG AA 50-100 Log in to see Polyclonal
1 ABIN1828013 ELISA WB Mouse IgG2b, kappa AA 101-200 Log in to see 3B9
1 ABIN763183 IHC (p) WB Biotin Rabbit IgG AA 50-100 Log in to see Polyclonal
1 ABIN1086915 ELISA WB Rabbit IgG Log in to see Polyclonal
1 ABIN1086916 ELISA WB Rabbit IgG Log in to see Polyclonal
1 ABIN2442268 WB Rabbit Middle Region Log in to see Polyclonal

Top referenced anti-GNAQ antibody for Western Blotting

Similar anti-GNAQ Antibodies

Application / Reactivity Human Mouse (Murine) Rat (Rattus)
Western Blotting (WB) 66 Antibodies 24 Antibodies 22 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 17 Antibodies 9 Antibodies 10 Antibodies
Immunohistochemistry (IHC) 4 Antibodies 2 Antibodies 1 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 13 Antibodies 13 Antibodies 13 Antibodies
Immunofluorescence (IF) 2 Antibodies 2 Antibodies 2 Antibodies
Enzyme Immunoassay (EIA) 1 Antibodies 1 Antibodies 1 Antibodies


Antigen Guanine Nucleotide Binding Protein (G Protein), Q Polypeptide (GNAQ) Antibodies
Epitope AA 102-138, N-Term
(15), (15), (14), (12), (4), (3), (3), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1)
Reactivity Human, Mouse (Murine), Rat (Rattus)
(82), (39), (36), (13), (11), (8), (4), (4), (4), (4), (3), (3), (3), (2)
Host Rabbit
(57), (16), (9)
Conjugate This GNAQ antibody is un-conjugated
(4), (4), (4), (3), (3), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(65), (36), (16), (13), (4), (2), (1)
Supplier Log in to see

Product Details anti-GNAQ Antibody

Target Details GNAQ Application Details Handling Images
Purpose Rabbit IgG polyclonal antibody for Guanine nucleotide-binding protein G(q) subunit alpha(GNAQ) detection. Tested with WB, IHC-P in Human,Rat,Mouse.
Cross-Reactivity (Details) No cross reactivity with other proteins.
Characteristics Rabbit IgG polyclonal antibody for Guanine nucleotide-binding protein G(q) subunit alpha(GNAQ) detection. Tested with WB, IHC-P in Human,Rat,Mouse.
Gene Name: guanine nucleotide binding protein (G protein), q polypeptide
Protein Name: Guanine nucleotide-binding protein G(q) subunit alpha
Purification Immunogen affinity purified.
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human GNAQ (102-138aa KYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWND), identical to the related mouse and rat sequences.
Isotype IgG

Target Details GNAQ

Product Details anti-GNAQ Antibody Application Details Handling Images back to top
Alternative Name GNAQ (GNAQ Antibody Abstract)
Background Guanine nucleotide-binding protein G(q) subunit alpha is a protein that in humans is encoded by the GNAQ gene. Guanine nucleotide-binding proteins are a family of heterotrimeric proteins that couple cell surface, 7-transmembrane domain receptors to intracellular signaling pathways. Receptor activation catalyzes the exchange of GDP for GTP bound to the inactive G protein alpha subunit resulting in a conformational change and dissociation of the complex. The G protein alpha and beta-gamma subunits are capable of regulating various cellular effectors. Activation is terminated by a GTPase intrinsic to the G-alpha subunit. G-alpha-q is the alpha subunit of one of the heterotrimeric GTP-binding proteins that mediates stimulation of phospholipase C-beta. Mutations in this gene have been found associated to cases of Sturge-Weber syndrome and port-wine stains.

Synonyms: CMC1 antibody|G alpha Q antibody|G protein alpha Q antibody|G-ALPHA-q antibody|GAQ antibody|GNAQ antibody|GNAQ_HUMAN antibody|guanine nucleotide binding protein (G protein), q polypeptide antibody|Guanine nucleotide binding protein alpha q antibody|guanine nucleotide binding protein G protein q polypeptide antibody|Guanine nucleotide binding protein G q subunit alpha antibody|Guanine nucleotide-binding protein alpha-q antibody|Guanine nucleotide-binding protein G(q) subunit alpha antibody|SWS antibody
Gene ID 2776
UniProt P50148
Research Area Cardiovascular
Pathways JAK-STAT Signaling, Thyroid Hormone Synthesis, Myometrial Relaxation and Contraction

Application Details

Product Details anti-GNAQ Antibody Target Details GNAQ Handling Images back to top
Application Notes WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions For Research Use only


Product Details anti-GNAQ Antibody Target Details GNAQ Application Details Images back to top
Format Lyophilized
Reconstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Concentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handling Advice Avoid repeated freezing and thawing.
Storage 4 °C/-20 °C
Storage Comment At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.


Product Details anti-GNAQ Antibody Target Details GNAQ Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-GNAQ antibody (Guanine Nucleotide Binding Protein (G Protein), Q Polypeptide) (AA 102-138) (ABIN3043833) anti-Guanine Nucleotide Binding Protein (G Protein), Q Polypeptide (GNAQ) (AA 102-138), (N-Term) antibody
Immunohistochemistry (IHC) image for anti-GNAQ antibody (Guanine Nucleotide Binding Protein (G Protein), Q Polypeptide) (AA 102-138) (ABIN3043833) IHC(P): Rat Ovary Tissue
Immunohistochemistry (IHC) image for anti-GNAQ antibody (Guanine Nucleotide Binding Protein (G Protein), Q Polypeptide) (AA 102-138) (ABIN3043833) IHC(P): Mouse Testis Tissue
Immunohistochemistry (IHC) image for anti-GNAQ antibody (Guanine Nucleotide Binding Protein (G Protein), Q Polypeptide) (AA 102-138) (ABIN3043833) IHC(P): Human Prostatic Cancer Tissue