You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human Oncostatin M Receptor antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended Oncostatin M Receptor Antibody (supplied by: Log in to see )

Antigen
Oncostatin M Receptor (OSMR) Antibodies
  • OSMRB
  • PLCA1
  • oncostatin M receptor
  • OSMR
  • Osmr
Reactivity
Human
52
8
5
2
Host
Rabbit
39
12
11
3
Clonality
Polyclonal
Conjugate
This Oncostatin M Receptor antibody is un-conjugated
7
4
3
3
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
43
23
12
5
5
3
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4341794
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN2626466 IHC (p) Rabbit IgG AA 612-661 Log in to see Polyclonal

Similar anti-Oncostatin M Receptor Antibodies

Application / Reactivity Human
ELISA 19 Antibodies
Enzyme Immunoassay (EIA) 1 Antibodies
Flow Cytometry (FACS) 9 Antibodies
Immunocytochemistry (ICC) 1 Antibodies
Immunohistochemistry (IHC) 4 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 2 Antibodies
Immunoprecipitation (IP) 3 Antibodies
Proximity Ligation Assay (PLA) 1 Antibodies
Western Blotting (WB) 38 Antibodies

General

Antigen Oncostatin M Receptor (OSMR) Antibodies
Reactivity Human
(52), (8), (5), (2)
Host Rabbit
(39), (12), (11), (3)
Clonality
Polyclonal
Conjugate This Oncostatin M Receptor antibody is un-conjugated
(7), (4), (3), (3), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(43), (23), (12), (5), (5), (3), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-Oncostatin M Receptor Antibody

Target Details Oncostatin M Receptor Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:IKETCYPDIPDPYKSSILSLIKFKENPHLIIMNVSDCIPDAIEVVSKPEGTKIQFLGTRKSLTETELTKPNYLYLLPTEKNHSGPGPCICFENLTYNQAASDSGSCGHVPVSPKAPSMLGLMTSPE
Isotype IgG

Target Details Oncostatin M Receptor

Product Details anti-Oncostatin M Receptor Antibody Application Details Handling Images back to top
Antigen
Alternative Name OSMR (OSMR Antibody Abstract)
Background Gene Symbol: OSMR
Gene ID 9180
UniProt Q99650
Research Area Cytokines, Innate Immunity, Chromatin and Nuclear Signaling
Pathways JAK-STAT Signaling

Application Details

Product Details anti-Oncostatin M Receptor Antibody Target Details Oncostatin M Receptor Handling Images back to top
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-Oncostatin M Receptor Antibody Target Details Oncostatin M Receptor Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-Oncostatin M Receptor Antibody Target Details Oncostatin M Receptor Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-Oncostatin M Receptor antibody (OSMR) (ABIN4341794) Immunocytochemistry/Immunofluorescence: OSMR Antibody [NBP1-82471] - Staining of huma...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Oncostatin M Receptor antibody (OSMR) (ABIN4341794) Immunohistochemistry-Paraffin: OSMR Antibody [NBP1-82471] - Immunohistochemical stain...