anti-Human Oncostatin M Receptor antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended Oncostatin M Receptor Antibody (supplied by: Log in to see )

Antigen
Oncostatin M Receptor (OSMR) Antibodies
  • OSMRB
  • PLCA1
  • oncostatin M receptor
  • OSMR
  • Osmr
Reactivity
Human
78
29
5
4
2
2
1
1
1
Host
Rabbit
44
29
23
16
Clonality
Polyclonal
Conjugate
This Oncostatin M Receptor antibody is un-conjugated
9
5
5
4
4
4
4
4
4
4
3
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
60
52
30
11
7
6
6
3
1
1
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4341794
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN2626466 IHC (p) WB Rabbit IgG AA 612-661 Log in to see Polyclonal

General

Antigen Oncostatin M Receptor (OSMR) Antibodies
Reactivity Human
(78), (29), (5), (4), (2), (2), (1), (1), (1)
Host Rabbit
(44), (29), (23), (16)
Clonality
Polyclonal
Conjugate This Oncostatin M Receptor antibody is un-conjugated
(9), (5), (5), (4), (4), (4), (4), (4), (4), (4), (3), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(60), (52), (30), (11), (7), (6), (6), (3), (1), (1), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-Oncostatin M Receptor Antibody

Target Details Oncostatin M Receptor Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:IKETCYPDIPDPYKSSILSLIKFKENPHLIIMNVSDCIPDAIEVVSKPEGTKIQFLGTRKSLTETELTKPNYLYLLPTEKNHSGPGPCICFENLTYNQAASDSGSCGHVPVSPKAPSMLGLMTSPE
Isotype IgG

Target Details Oncostatin M Receptor

Product Details anti-Oncostatin M Receptor Antibody Application Details Handling Images back to top
Antigen
Alternative Name OSMR (OSMR Antibody Abstract)
Background Gene Symbol: OSMR
Gene ID 9180
UniProt Q99650
Research Area Cytokines, Innate Immunity, Chromatin and Nuclear Signaling
Pathways JAK-STAT Signaling, Growth Factor Binding

Application Details

Product Details anti-Oncostatin M Receptor Antibody Target Details Oncostatin M Receptor Handling Images back to top
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-Oncostatin M Receptor Antibody Target Details Oncostatin M Receptor Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-Oncostatin M Receptor Antibody Target Details Oncostatin M Receptor Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-Oncostatin M Receptor (OSMR) antibody (ABIN4341794) Immunocytochemistry/Immunofluorescence: OSMR Antibody [NBP1-82471] - Staining of huma...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Oncostatin M Receptor (OSMR) antibody (ABIN4341794) Immunohistochemistry-Paraffin: OSMR Antibody [NBP1-82471] - Immunohistochemical stain...