You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human MKNK2 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended MKNK2 Antibody (supplied by: Log in to see )

Antigen
MAP Kinase Interacting serine/threonine Kinase 2 (MKNK2) Antibodies
  • 2010016G11Rik
  • gprk7
  • Gprk7
  • GPRK7
  • mknk2
  • MNK2
  • Mnk2
  • mnk2
  • wu:fb37e05
  • wz5090
Reactivity
Human
67
24
7
1
1
1
1
Host
Rabbit
69
15
Clonality
Polyclonal
Conjugate
This MKNK2 antibody is un-conjugated
7
7
7
7
7
7
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
79
60
6
6
2
2
2
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4335144
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
0.23987994 ABIN4891975 IHC IHC (p) WB Rabbit N-Term Log in to see Polyclonal
0.0008986142 ABIN490048 IHC (p) WB Rabbit IgG N-Term Log in to see Polyclonal

Similar anti-MKNK2 Antibodies

Application / Reactivity Human
ELISA 46 Antibodies
Enzyme Immunoassay (EIA) 2 Antibodies
Immunocytochemistry (ICC) 7 Antibodies
Immunofluorescence (IF) 7 Antibodies
Immunohistochemistry (IHC) 3 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 3 Antibodies
Proximity Ligation Assay (PLA) 1 Antibodies
Western Blotting (WB) 65 Antibodies

General

Antigen MAP Kinase Interacting serine/threonine Kinase 2 (MKNK2) Antibodies
Reactivity Human
(67), (24), (7), (1), (1), (1), (1)
Host Rabbit
(69), (15)
Clonality
Polyclonal
Conjugate This MKNK2 antibody is un-conjugated
(7), (7), (7), (7), (7), (7)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(79), (60), (6), (6), (2), (2), (2), (1)
Supplier Log in to see

Product Details anti-MKNK2 Antibody

Target Details MKNK2 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:ELQGFHRSFKGQNPFELAFSLDQPDHGDSDFGLQCSARPDMPASQPIDIPDAKKRGKKKKRGRATDSFSGRFEDVYQLQEDVLGEGAHARVQTCINLITSQE
Isotype IgG

Target Details MKNK2

Product Details anti-MKNK2 Antibody Application Details Handling Images back to top
Antigen
Alternative Name MNK2 (MKNK2 Antibody Abstract)
Background Gene Symbol: MKNK2
Research Area Signaling
Pathways MAPK Signaling

Application Details

Product Details anti-MKNK2 Antibody Target Details MKNK2 Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-MKNK2 Antibody Target Details MKNK2 Application Details Images back to top
Format Liquid
Buffer Phospate buffered saline, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-MKNK2 Antibody Target Details MKNK2 Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-MKNK2 antibody (MAP Kinase Interacting serine/threonine Kinase 2) (ABIN4335144) Immunocytochemistry/Immunofluorescence: MNK2 Antibody [NBP1-92129] - Staining of huma...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-MKNK2 antibody (MAP Kinase Interacting serine/threonine Kinase 2) (ABIN4335144) Immunohistochemistry-Paraffin: MNK2 Antibody [NBP1-92129] - Staining of human gall bl...
Western Blotting (WB) image for anti-MKNK2 antibody (MAP Kinase Interacting serine/threonine Kinase 2) (ABIN4335144) Western Blot: MNK2 Antibody [NBP1-92129] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55,...