anti-Human MKNK2 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended MKNK2 Antibody (supplied by: Log in to see )

MAP Kinase Interacting serine/threonine Kinase 2 (MKNK2) Antibodies
  • gprk7
  • mnk2
  • GPRK7
  • MNK2
  • 2010016G11Rik
  • Gprk7
  • Mnk2
  • mknk2
  • wu:fb37e05
  • wz5090
  • MAP kinase interacting serine/threonine kinase 2
  • MAP kinase-interacting serine/threonine kinase 2
  • MAP kinase-interacting serine/threonine kinase 2b
  • MKNK2
  • mknk2
  • Mknk2
  • mknk2b
This MKNK2 antibody is un-conjugated
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4891975
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
13.399764 ABIN4335144 ICC IF IHC IHC (p) WB Rabbit IgG Log in to see Polyclonal
1 ABIN490048 IHC (p) WB Rabbit IgG AA 36-85 Log in to see Polyclonal

Similar anti-MKNK2 Antibodies

Application / Reactivity Human
ELISA 45 Antibodies
Enzyme Immunoassay (EIA) 2 Antibodies
Immunocytochemistry (ICC) 8 Antibodies
Immunofluorescence (IF) 8 Antibodies
Immunohistochemistry (IHC) 3 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 3 Antibodies
Proximity Ligation Assay (PLA) 1 Antibodies
Western Blotting (WB) 69 Antibodies


Antigen MAP Kinase Interacting serine/threonine Kinase 2 (MKNK2) Antibodies
Epitope N-Term
(33), (21), (14), (9), (5), (4), (4), (4), (3), (3), (1), (1), (1), (1)
Reactivity Human
(70), (25), (7), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Host Rabbit
(72), (15)
Conjugate This MKNK2 antibody is un-conjugated
(7), (7), (7), (7), (7), (7)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(84), (59), (8), (8), (2), (2), (2), (1)
Supplier Log in to see

Product Details anti-MKNK2 Antibody

Target Details MKNK2 Application Details Handling Images
Purification Immunogen affinity purified
Immunogen Synthetic peptides corresponding to MKNK2(MAP kinase interacting serine/threonine kinase 2) The peptide sequence was selected from the N terminal of MKNK2. Peptide sequence SDFGLQCSARPDMPASQPIDIPDAKKRGKKKKRGRATDSFSGRFEDVYQL.

Target Details MKNK2

Product Details anti-MKNK2 Antibody Application Details Handling Images back to top
Alternative Name MNK2 (MKNK2 Antibody Abstract)
Background Gene Symbol: MKNK2
Molecular Weight Theoretical MW: 51 kDa
Gene ID 2872
UniProt Q9HBH9
Research Area Signaling
Pathways MAPK Signaling

Application Details

Product Details anti-MKNK2 Antibody Target Details MKNK2 Handling Images back to top
Application Notes Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500This is a rabbit polyclonal antibody against MKNK2 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-MKNK2 Antibody Target Details MKNK2 Application Details Images back to top
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.


Product Details anti-MKNK2 Antibody Target Details MKNK2 Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-MKNK2 antibody (MAP Kinase Interacting serine/threonine Kinase 2) (N-Term) (ABIN4891975) Immunohistochemistry: MNK2 Antibody [NBP1-58899] - Staining of human Spleen.
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-MKNK2 antibody (MAP Kinase Interacting serine/threonine Kinase 2) (N-Term) (ABIN4891975) Immunohistochemistry-Paraffin: MNK2 Antibody [NBP1-58899] - Human Placenta Tissue, 5....
Western Blotting (WB) image for anti-MKNK2 antibody (MAP Kinase Interacting serine/threonine Kinase 2) (N-Term) (ABIN4891975) Western Blot: MNK2 Antibody [NBP1-58899] - Titration: 1 ug/ml Positive Control: 721_B...