You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human KIF2C antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended KIF2C Antibody (supplied by: Log in to see )

Antigen
Kinesin Family Member 2C (KIF2C) Antibodies
  • 4930402F02Rik
  • ESTM5
  • kcm1
  • kif2c
  • KIF2C
  • KNSL6
  • Knsl6
  • KRP2
  • mcak
  • MCAK
  • MGC89391
  • si:ch211-61f14.1
  • X83316
Reactivity
Human
80
22
9
3
1
1
1
1
Host
Rabbit
67
19
Clonality
Polyclonal
Conjugate
This KIF2C antibody is un-conjugated
3
3
3
3
3
3
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
69
34
27
16
15
14
10
6
3
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4328841
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
0.2458586 ABIN4328842 FACS ICC IF IHC IHC (p) WB Mouse IgG1 Log in to see 1C5
0.0008918543 ABIN564770 IF IHC (p) IP RNAi ELISA WB Mouse IgG1 kappa AA 1-100, partial Log in to see 1G2 2
0.0008918543 ABIN3043278 IHC (p) WB Rabbit IgG AA 531-725 Log in to see Polyclonal
0.0008918543 ABIN599163 IF IHC (p) IP ELISA WB Mouse IgG1, kappa Log in to see 1G2
0.0008918543 ABIN2624492 IHC (p) WB Rabbit IgG AA 531-725 Log in to see Polyclonal
0.0008918543 ABIN2611450 IF IHC (p) ELISA Mouse IgG1 AA 1-100 Log in to see
0.0008918543 ABIN2963223 IF IP IHC (p) Rabbit IgG AA 50-100 Log in to see Polyclonal
0.0008918543 ABIN3031553 IHC (p) WB Rabbit IgG AA 531-725 Log in to see Polyclonal

Top referenced anti-KIF2C antibody for Immunohistochemistry (Paraffin-embedded Sections)

Similar anti-KIF2C Antibodies

Application / Reactivity Human
Dot Blot (DB) 3 Antibodies
ELISA 34 Antibodies
Flow Cytometry (FACS) 6 Antibodies
Immunoassay (IA) 1 Antibodies
Immunochromatography (IC) 1 Antibodies
Immunocytochemistry (ICC) 16 Antibodies
Immunofluorescence (IF) 26 Antibodies
Immunohistochemistry (IHC) 15 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 9 Antibodies
Immunoprecipitation (IP) 11 Antibodies
RNA Interference (RNAi) 1 Antibodies
Western Blotting (WB) 66 Antibodies

General

Antigen Kinesin Family Member 2C (KIF2C) Antibodies
Reactivity Human
(80), (22), (9), (3), (1), (1), (1), (1)
Host Rabbit
(67), (19)
Clonality
Polyclonal
Conjugate This KIF2C antibody is un-conjugated
(3), (3), (3), (3), (3), (3)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(69), (34), (27), (16), (15), (14), (10), (6), (3), (1), (1), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-KIF2C Antibody

Target Details KIF2C Application Details Handling References for anti-KIF2C Antibody (ABIN4328841) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RYADRVKELSPHSGPSGEQLIQMETEEMEACSNGALIPGNLSKEEEELSSQMSSFNEAMTQIRELEEKAMEELKEIIQQGPDWLELSEMTEQPDYDLETFVNKAESALAQQAKHFSALR
Isotype IgG

Target Details KIF2C

Product Details anti-KIF2C Antibody Application Details Handling References for anti-KIF2C Antibody (ABIN4328841) Images back to top
Antigen
Alternative Name KIF2C (KIF2C Antibody Abstract)
Background Gene Symbol: KIF2C
Pathways Microtubule Dynamics

Application Details

Product Details anti-KIF2C Antibody Target Details KIF2C Handling References for anti-KIF2C Antibody (ABIN4328841) Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-KIF2C Antibody Target Details KIF2C Application Details References for anti-KIF2C Antibody (ABIN4328841) Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-KIF2C Antibody (ABIN4328841)

Product Details anti-KIF2C Antibody Target Details KIF2C Application Details Handling Images back to top
Product cited in:

Stadler, Rexhepaj, Singan, Murphy, Pepperkok, Uhlén, Simpson, Lundberg: "Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells." in: Nature methods, Vol. 10, Issue 4, pp. 315-23, 2013

Images

Product Details anti-KIF2C Antibody Target Details KIF2C Application Details Handling References for anti-KIF2C Antibody (ABIN4328841) back to top
Supplier Images
Immunofluorescence (IF) image for anti-KIF2C antibody (Kinesin Family Member 2C) (ABIN4328841) Immunocytochemistry/Immunofluorescence: KIF2C Antibody [NBP1-82870] - Staining of hum...
Western Blotting (WB) image for anti-KIF2C antibody (Kinesin Family Member 2C) (ABIN4328841) Western Blot: KIF2C Antibody [NBP1-82870] - Lane 1: Marker [kDa] 229, 112, 84, 48, 32...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-KIF2C antibody (Kinesin Family Member 2C) (ABIN4328841) Immunohistochemistry-Paraffin: KIF2C Antibody [NBP1-82870] - Staining of human small ...