anti-Human TBX2 antibody for Immunofluorescence

Recommended TBX2 Antibody (supplied by: Log in to see )

Antigen
T-Box 2 (TBX2) Antibodies
  • Xltbx2
  • tbx2
  • xtbx2
  • hm:zeh1581
  • tbx-c
  • tbxc
  • zeh1581
  • TBX2
  • T-box 2
  • T-box 2b
  • Protein TBX-2
  • TBX2
  • tbx2-a
  • tbx2b
  • tbx2
  • tbx-2
  • Tbx2
Reactivity
Human
73
18
10
4
4
3
2
2
2
2
2
1
Host
Rabbit
50
24
1
Clonality
Polyclonal
Conjugate
This TBX2 antibody is un-conjugated
3
3
3
3
3
3
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
62
45
14
10
8
6
5
2
2
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4358058
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
11.0032625 ABIN563097 IF RNAi ELISA WB Mouse IgG3 kappa AA 603-702, partial Log in to see 7G5
1 ABIN4948268 IF WB Mouse IgG3 kappa AA 603-703 Log in to see 7G5 5
1 ABIN1828994 IF RNAi ELISA WB Mouse IgG3, kappa AA 603-702 Log in to see 7G5
1 ABIN2573590 IF ELISA WB Mouse IgG3 AA 603-703 Log in to see
1 ABIN2372431 IF ELISA WB Mouse IgG3 kappa AA 603-703 Log in to see 7G5

General

Antigen T-Box 2 (TBX2) Antibodies
Reactivity Human
(73), (18), (10), (4), (4), (3), (2), (2), (2), (2), (2), (1)
Host Rabbit
(50), (24), (1)
Clonality
Polyclonal
Conjugate This TBX2 antibody is un-conjugated
(3), (3), (3), (3), (3), (3)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(62), (45), (14), (10), (8), (6), (5), (2), (2), (1), (1)
Pubmed 2 references available
Supplier Log in to see

Product Details anti-TBX2 Antibody

Target Details TBX2 Application Details Handling ProductDetails: References for anti-TBX2 antibody (ABIN4358058) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:IPMPTFGGLFPYPYTYMAAAAAAASALPATSAAAAAAAAAGSLSRSPFLGSARPRLRFSPYQIPVTIPPSTSLLTTGLASEGSKAAGGNSREPSPLPELALRKVGAPSRGALSPSGSAKEAANELQSIQRLVSGL
Isotype IgG

Target Details TBX2

Product Details anti-TBX2 Antibody Application Details Handling ProductDetails: References for anti-TBX2 antibody (ABIN4358058) Images back to top
Antigen
Alternative Name TBX2 (TBX2 Antibody Abstract)
Background Gene Symbol: TBX2
Gene ID 6909
Pathways p53 Signaling

Application Details

Product Details anti-TBX2 Antibody Target Details TBX2 Handling ProductDetails: References for anti-TBX2 antibody (ABIN4358058) Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended. For IF Fixation/Permeabilization: PFA/Triton X-100 is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-TBX2 Antibody Target Details TBX2 Application Details ProductDetails: References for anti-TBX2 antibody (ABIN4358058) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

ProductDetails: References for anti-TBX2 antibody (ABIN4358058)

Product Details anti-TBX2 Antibody Target Details TBX2 Application Details Handling Images back to top
Product cited in:

Schneider, Scheffer, Bund, Boukhallouk, Lambert, Cotarelo, Pflugfelder, Florin, Spoden: "The transcription factors TBX2 and TBX3 interact with human papillomavirus 16 (HPV16) L2 and repress the long control region of HPVs." in: Journal of virology, Vol. 87, Issue 8, pp. 4461-74, 2013

Saadi, Das, Zhao, Raj, Ruspita, Xia, Papaioannou, Bei: "Msx1 and Tbx2 antagonistically regulate Bmp4 expression during the bud-to-cap stage transition in tooth development." in: Development (Cambridge, England), Vol. 140, Issue 13, pp. 2697-702, 2013 (Sample species: Mouse (Murine)). Further details: Immunohistochemistry

Images

Product Details anti-TBX2 Antibody Target Details TBX2 Application Details Handling ProductDetails: References for anti-TBX2 antibody (ABIN4358058) back to top
Supplier Images
Immunofluorescence (IF) image for anti-T-Box 2 (TBX2) antibody (ABIN4358058) Immunocytochemistry/Immunofluorescence: TBX2 Antibody - Staining of human cell line ...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-T-Box 2 (TBX2) antibody (ABIN4358058) Immunohistochemistry-Paraffin: TBX2 Antibody - Staining of human stomach shows stron...