You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Rat (Rattus) PPP2R2B antibody for Western Blotting

Recommended PPP2R2B Antibody (supplied by: Log in to see )

Antigen
Protein Phosphatase 2, Regulatory Subunit B, beta (PPP2R2B) Antibodies
  • ppp2r2b
  • ppp2r2b-a
  • ppp2r2c
  • zgc:101861
  • PPP2R2B
  • 2900026H06Rik
  • 6330404L05Rik
  • E130009M08Rik
  • PP2A-PR55B
  • PR55-BETA
  • SCA12
  • B55BETA
  • PP2AB55BETA
  • PP2ABBETA
  • PP2APR55B
  • PP2APR55BETA
  • PR2AB55BETA
  • PR2ABBETA
  • PR2APR55BETA
  • PR52B
  • PR55BETA
  • Pppr2b2
  • PP2A
  • protein phosphatase 2, regulatory subunit B, beta
  • protein phosphatase 2, regulatory subunit B, alpha
  • protein phosphatase 2, regulatory subunit B, beta b
  • protein phosphatase 2 (formerly 2A), regulatory subunit B, beta isoform
  • protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), beta isoform
  • PPP2R2B
  • ppp2r2a
  • ppp2r2b
  • ppp2r2bb
  • Ppp2r2b
Reactivity
Human, Mouse (Murine), Rat (Rattus)
51
10
9
1
Host
Rabbit
39
12
Clonality
Polyclonal
Conjugate
This PPP2R2B antibody is un-conjugated
2
2
2
2
2
2
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
45
34
10
9
9
6
5
2
2
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4347091
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
2.9499688 ABIN4904840 WB Rabbit IgG Log in to see Polyclonal
2.9499688 ABIN1852112 ELISA WB Rabbit Internal Region Log in to see Polyclonal
1 ABIN264942 WB Rabbit IgG N-Term, AA 2-14 Log in to see Polyclonal
1 ABIN1090924 ELISA WB Rabbit IgG Regulatory Subunit B, beta Log in to see Polyclonal
1 ABIN1090925 ELISA WB Rabbit IgG Regulatory Subunit B, beta Log in to see Polyclonal
1 ABIN2499522 ELISA WB Rabbit IgG Log in to see Polyclonal
1 ABIN1579018 ELISA WB Rabbit Internal Region Log in to see Polyclonal
1 ABIN3060792 ICC IF IP WB Rabbit Log in to see Polyclonal

Similar anti-PPP2R2B Antibodies

Application / Reactivity Rat (Rattus) Mouse (Murine) Human
ELISA 5 Antibodies 5 Antibodies 34 Antibodies
Immunocytochemistry (ICC) 1 Antibodies 1 Antibodies 2 Antibodies
Immunofluorescence (IF) 1 Antibodies 1 Antibodies
Immunohistochemistry (IHC) 1 Antibodies 2 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 1 Antibodies 2 Antibodies
Immunoprecipitation (IP) 1 Antibodies 1 Antibodies
Western Blotting (WB) 9 Antibodies 10 Antibodies
Enzyme Immunoassay (EIA) 2 Antibodies
Flow Cytometry (FACS) 6 Antibodies

General

Antigen Protein Phosphatase 2, Regulatory Subunit B, beta (PPP2R2B) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(51), (10), (9), (1)
Host Rabbit
(39), (12)
Clonality
Polyclonal
Conjugate This PPP2R2B antibody is un-conjugated
(2), (2), (2), (2), (2), (2)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(45), (34), (10), (9), (9), (6), (5), (2), (2)
Supplier Log in to see

Product Details anti-PPP2R2B Antibody

Target Details PPP2R2B Application Details Handling Images
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: YNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNA
Isotype IgG

Target Details PPP2R2B

Product Details anti-PPP2R2B Antibody Application Details Handling Images back to top
Antigen
Alternative Name PPP2R2B (PPP2R2B Antibody Abstract)
Background Gene Symbol: PPP2R2B
Gene ID 5521
UniProt Q00005
Research Area Neurology
Pathways PI3K-Akt Signaling

Application Details

Product Details anti-PPP2R2B Antibody Target Details PPP2R2B Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-PPP2R2B Antibody Target Details PPP2R2B Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-PPP2R2B Antibody Target Details PPP2R2B Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-PPP2R2B antibody (Protein Phosphatase 2, Regulatory Subunit B, beta) (ABIN4347091) Western Blot: PPP2R2B Antibody [NBP2-46667] - Lane 1: Marker [kDa] 250, 130, 95, 72, ...
Immunohistochemistry (IHC) image for anti-PPP2R2B antibody (Protein Phosphatase 2, Regulatory Subunit B, beta) (ABIN4347091) Immunohistochemistry: PPP2R2B Antibody [NBP2-46667] - Analysis of human cerebral cort...
Western Blotting (WB) image for anti-PPP2R2B antibody (Protein Phosphatase 2, Regulatory Subunit B, beta) (ABIN4347091) Western Blot: PPP2R2B Antibody [NBP2-46667] - Lane 1: NIH-3T3 cell lysate (Mouse embr...
Immunohistochemistry (IHC) image for anti-PPP2R2B antibody (Protein Phosphatase 2, Regulatory Subunit B, beta) (ABIN4347091) Immunohistochemistry: PPP2R2B Antibody [NBP2-46667] - Analysis of human liver tissue.
Immunohistochemistry (IHC) image for anti-PPP2R2B antibody (Protein Phosphatase 2, Regulatory Subunit B, beta) (ABIN4347091) Immunohistochemistry: PPP2R2B Antibody [NBP2-46667] - Analysis of human liver cancer.