Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN1046758

Carbonic Anhydrase IX (CA9) protein (GST tag)

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Protein Name
Synonyms MN, CAIX, Ca9, MN/CA9, CA9
Origin
»Alternatives Human
Host
Protein Type Recombinant
Purification tag / Conjugate
GST tag
Application
SDS-PAGE (SDS), ELISA
Pubmed 3 references available
Catalog no. ABIN1046758
Quantity 1 mg
Price
1,842.50 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 9 to 11 Business Days
Sequence DLPSEEDSPREEDPPGEEDLPGEEDLPGEEDLPEVKPKSE EEGSLKLEDLPTVEAPGDPQEPQNNAHRDKEGDDQSHWRY GGDPPWPRVSPACAGRFQSPVDIRPQLAAFCPALRPLELL GFQLPPLPELRLRNNGHSVQLTLPPGLEMALGPGREYRAL QLHLHWGAAGRPGSEHTVEGHRFPAEIHVVHLSTAFARVD EALGRPGGLAVLAAFLEEGPEENSAYEQLLSRLEEIAEEG SETQVPGLDISALLPSDFSRYFQYEGSLTTPPCAQGVIWT VFNQTVMLSAKQLHTLSDTLWGPGDSRLQLNFRATQPLNG RVIEASFPAGVDSSPR
Characteristics Reversible hydration of carbon dioxide. Participates in pH regulation. May be involved in the control of cell proliferation and transformation. Appears to be a novel specific biomarker for a cervical neoplasia.
Purity 90%
Alternative Name Carbonic anhydrase 9
Background Synonyms: Carbonate dehydratase IX,Carbonic anhydrase IX,CA-IX,CAIX,Membrane antigen MN,P54/58N,Renal cell carcinoma-associated antigen G250,RCC-associated antigen G250,pMW1
Molecular Weight 64 kDa
Research Area Enzymes, Metabolism
Comment

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Restrictions For Research Use only
Buffer PBS buffer, 20mM GSH
Storage -20 °C
Product cited in: Pastorek, Pastoreková, Callebaut et al.: "Cloning and characterization of MN, a human tumor-associated protein with a domain homologous to carbonic anhydrase and a putative helix-loop-helix DNA binding segment." in: Oncogene, Vol. 9, Issue 10, pp. 2877-88, 1994 (PubMed).

Grabmaier, Vissers, De Weijert et al.: "Molecular cloning and immunogenicity of renal cell carcinoma-associated antigen G250." in: International journal of cancer. Journal international du cancer, Vol. 85, Issue 6, pp. 865-70, 2000 (PubMed).

Humphray, Oliver, Hunt et al.: "DNA sequence and analysis of human chromosome 9." in: Nature, Vol. 429, Issue 6990, pp. 369-74, 2004 (PubMed).

Alternatives for antigen "Carbonic Anhydrase IX (CA9)", type "Proteins"
Hosts (6), (1)
Reactivities (9), (4)
Beacon