Did you know that you can buy products from over 140 different suppliers from us?

Cathepsin D (CTSD) (AA 67-403), (partial) protein (GST tag)

Details for Product No. ABIN1046778
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Protein Name
Synonyms CLN10, CPSD, CD, CatD, catD, fb93e11, fj17b09, wu:fb93e11, wu:fj17b09, LOC398557, Cathd, LOC100136761, CTSD, DKFZp469J0315, DDBDRAFT_0205785, DDBDRAFT_0215012, DDB_0205785, DDB_0215012
Protein Characteristics
AA 67-403, partial
Origin
Human
(32), (4), (2), (1), (1)
Source
Escherichia coli (E. coli)
(18), (5), (5), (2), (2)
Protein Type Recombinant
Purification tag / Conjugate
GST tag
Application
SDS-PAGE (SDS), ELISA
Pubmed 3 references available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 9 to 11 Business Days
Catalog No. ABIN1046778
242.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Sequence IPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVP SIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGS LSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQP GITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQ NIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTR KAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVD EVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKG YKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILG DVFIGRYYTVFDRDNNR
Characteristics Acid protease active in intracellular protein breakdown. Involved in the pathogenesis of several diseases such as breast cancer and possibly Alzheimer disease.
Purity 90%
Alternative Name Cathepsin D
Molecular Weight 64.2 kD
UniProt P07339
Research Area Proteolysis / Ubiquitin, Extracellular Matrix, Proteases, Signaling
Comment

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Restrictions For Research Use only
Buffer PBS buffer, 20mM GSH
Storage -20 °C
Product cited in: Redecker, Heckendorf, Grosch et al.: "Molecular organization of the human cathepsin D gene." in: DNA and cell biology, Vol. 10, Issue 6, pp. 423-31, 1991 (PubMed).

Westley, May: "Oestrogen regulates cathepsin D mRNA levels in oestrogen responsive human breast cancer cells." in: Nucleic acids research, Vol. 15, Issue 9, pp. 3773-86, 1987 (PubMed).

Faust, Kornfeld, Chirgwin: "Cloning and sequence analysis of cDNA for human cathepsin D." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 82, Issue 15, pp. 4910-4, 1985 (PubMed).

Hosts (18), (5), (5), (2), (2)
Reactivities (32), (4), (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN1046778
242.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top