Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN1046780

Cathepsin D (CTSD) protein (GST tag)

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Protein Name
Synonyms CLN10, CPSD, CD, CatD, catD, fb93e11, fj17b09, wu:fb93e11, wu:fj17b09, LOC398557, Cathd, LOC100136761, CTSD, DKFZp469J0315, DDBDRAFT_0205785, DDBDRAFT_0215012, DDB_0205785, DDB_0215012
Origin
»Alternatives Human
Host
Protein Type Recombinant
Purification tag / Conjugate
GST tag
Application
SDS-PAGE (SDS), ELISA
Pubmed 3 references available
Catalog no. ABIN1046780
Quantity 10 µg
Price
327.80 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 9 to 11 Business Days
Sequence IPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVP SIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGS LSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQP GITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQ NIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTR KAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVD EVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKG YKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILG DVFIGRYYTVFDRDNNR
Characteristics Acid protease active in intracellular protein breakdown. Involved in the pathogenesis of several diseases such as breast cancer and possibly Alzheimer disease.
Purity 90%
Alternative Name Cathepsin D
Molecular Weight 64 kDa
Research Area Proteolysis / Ubiquitin, Extracellular Matrix, Proteases, Signaling
Comment

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Restrictions For Research Use only
Buffer PBS buffer, 20mM GSH
Storage -20 °C
Product cited in: Redecker, Heckendorf, Grosch et al.: "Molecular organization of the human cathepsin D gene." in: DNA and cell biology, Vol. 10, Issue 6, pp. 423-31, 1991 (PubMed).

Westley, May: "Oestrogen regulates cathepsin D mRNA levels in oestrogen responsive human breast cancer cells." in: Nucleic acids research, Vol. 15, Issue 9, pp. 3773-86, 1987 (PubMed).

Faust, Kornfeld, Chirgwin: "Cloning and sequence analysis of cDNA for human cathepsin D." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 82, Issue 15, pp. 4910-4, 1985 (PubMed).

Alternatives for antigen "Cathepsin D (CTSD)", type "Proteins"
Hosts (10), (5), (4), (2)
Reactivities (31), (1), (1), (1), (1)
Beacon