Did you know that you can buy products from over 140 different suppliers from us?

Guanine Nucleotide-Binding Protein G(I)/G(S)/G(T) (AA 21-327), (partial) protein (GST tag)

Details for Product No. ABIN1047142
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Protein Name
Protein Characteristics
AA 21-327, partial
Origin
Human
(3)
Source
Escherichia coli (E. coli)
(3)
Protein Type Recombinant
Purification tag / Conjugate
GST tag
Application
SDS-PAGE (SDS), ELISA
Pubmed 3 references available
Quantity 1 mg
Options
Shipping to United States (Change)
Availability Will be delivered in 9 to 11 Business Days
Catalog No. ABIN1047142
1,842.50 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Sequence RKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYAM HWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVM TCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPG HTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGFA GHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQT FIGHESDINAVAFFPNGYAFTTGSDDATCRLFDLRADQEL LMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAMK GDRAGVLAGHDNRVSCLGVTDDGMAVA
Characteristics Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.
Purity 90%
Background Synonyms: G protein subunit beta-2,Transducin beta chain 2
Molecular Weight 60.7 kD
UniProt P62879
Comment

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Restrictions For Research Use only
Buffer PBS buffer, 20mM GSH
Storage -20 °C
Product cited in: Fong, Amatruda, Birren et al.: "Distinct forms of the beta subunit of GTP-binding regulatory proteins identified by molecular cloning." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 84, Issue 11, pp. 3792-6, 1987 (PubMed).

Gao, Gilman, Robishaw: "A second form of the beta subunit of signal-transducing G proteins." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 84, Issue 17, pp. 6122-5, 1987 (PubMed).

Glöckner, Scherer, Schattevoy et al.: "Large-scale sequencing of two regions in human chromosome 7q22: analysis of 650 kb of genomic sequence around the EPO and CUTL1 loci reveals 17 genes." in: Genome research, Vol. 8, Issue 10, pp. 1060-73, 1998 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN1047142
1,842.50 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top