CCM2 Protein (His tag)
-
- Target See all CCM2 Proteins
- CCM2 (Cerebral Cavernous Malformation 2 (CCM2))
- Protein Type
- Recombinant
-
Origin
- Human
-
Source
- Escherichia coli (E. coli)
- Purification tag / Conjugate
- This CCM2 protein is labelled with His tag.
- Sequence
- MGSSHHHHHHSSGLVPRGSHMEEEGKKGKKPGIVSPFKRV FLKGEKSRDKKAHEKVTERRPLHTVVLSLPERVEPDRLLS DYIEKEVKYLGQLTSIPGYLNPSSRTEILHFIDNAKRAHQ LPGHLTQEHDAVLSLSAYNVKLAWRDGEDIILRVPIHDIA AVSYVRDDAAHLVVLKTAQDPGISPSQSLCAESSRGLSAG SLSESAVGPVEACCLVILAAESKVAAEELCCLLGQVFQVV YTESTIDFLDRAIFDGASTPTHHLSLHSDDSSTKVDIKET YEVEASTFCFPESVDVGGASPHSKTISESELSASATELLQ DYMLTLRTKLSSQEIQQFAALLHEYRNGASIHEFCINLRQ LYGDSRKFLLLGLRPFIPEKDSQHFENFLETIGVKDGRGI ITDSFGRHRRALSTTSSSTTNGNRATGSSDDRSAPSEGDE WDRMISDISSDIEALGCSMDQDSA
- Characteristics
-
Length (AA): 464
Chromosomal location: 7p13 - Purity
- > 95 % by SDS-PAGE. Visualized by silver stain
- Top Product
- Discover our top product CCM2 Protein
-
-
- Application Notes
- Not tested so far.
- Comment
-
Cytokines & Growth Factors
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- The lyophilized CCM-2 is soluble in water and most aqueous buffers and should be reconstituted in water or PBS.
- Buffer
- PBS
- Storage
- 0 °C
- Storage Comment
- The lyophilized human CCM2, though stable at room temperature, is best stored desiccated below 0 °C.
-
- Target
- CCM2 (Cerebral Cavernous Malformation 2 (CCM2))
- Alternative Name
- CCM-2 (CCM2 Products)
- Synonyms
- C7orf22 Protein, OSM Protein, malcavernin Protein, CCM2 Protein, BC029157 Protein, TUF2 Protein, vtn Protein, zgc:110233 Protein, CCM2 scaffolding protein Protein, cerebral cavernous malformation 2 Protein, malcavernin Protein, CCM2 Protein, Ccm2 Protein, LOC100304744 Protein, ccm2 Protein
- Background
-
Cerebral cavernous malformations (CCMs) are sporadically acquired or inherited vascular lesions of the central nervous system consisting of clusters of dilated thin-walled blood vessels that predispose individuals to seizures and stroke. Familial CCM is caused by mutations in KRIT1 (CCM1) or in malcavernin (CCM2). The roles of the CCM proteins in the pathogenesis of the disorder remain largely unknown. It was shown that the CCM1 gene product, KRIT1, interacts with the CCM2 gene product, malcavernin. Analogous to the established interactions of CCM1 and beta1 integrin with ICAP1, the CCM1/CCM2 association is dependent upon the phosphotyrosine binding (PTB) domain of CCM2. A familial CCM2 missense mutation abrogates the CCM1/CCM2 interaction, suggesting that loss of this interaction may be critical in CCM pathogenesis. CCM2 and ICAP1 bound to CCM1 via their respective PTB domains differentially influence the subcellular localization of CCM1. The data indicate that the genetic heterogeneity observed in familial CCM may reflect mutation of different molecular members of a coordinated signaling complex. The CCM-2 is fused to a N-terminal His-tag (6x His).
Synonyms: CCM-2, malcavernin, cerebral cavernous malformation 2, OSM, C7orf22, PP10187 - Molecular Weight
- 51.0 kDa
- NCBI Accession
- NP_001025006, NM_001029835
- UniProt
- Q9BSQ5
- Pathways
- Cell-Cell Junction Organization
-