You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human CSF1 antibody for Immunofluorescence

Recommended CSF1 Antibody (supplied by: Log in to see )

Antigen
Colony Stimulating Factor 1 (Macrophage) (CSF1) Antibodies
  • CSF1
  • csf1-1
  • zgc:172186
  • CSF-1
  • MCSF
  • C87615
  • Csfm
  • op
  • colony stimulating factor 1 (macrophage)
  • colony stimulating factor 1a (macrophage)
  • macrophage colony stimulating factor alpha
  • CSF1
  • csf1a
  • Csf1
  • MCSF ALPHA
Reactivity
Human
151
55
26
6
3
3
3
1
1
1
1
Host
Rabbit
111
59
7
3
2
Clonality
Polyclonal
Conjugate
This CSF1 antibody is un-conjugated
11
7
7
4
3
3
3
3
3
2
2
2
2
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF)
122
86
49
27
19
18
13
8
3
2
2
2
2
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN5077930
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN390719 FACS IF IHC (p) WB Rabbit Ig AA 230-257, Center Log in to see Polyclonal 1
1 ABIN2781823 IF IHC WB Rabbit Middle Region Log in to see Polyclonal
1 ABIN2781824 IF IHC WB Rabbit Middle Region Log in to see Polyclonal
1 ABIN5534396 FACS IF IHC (p) WB Rabbit Ig Fraction AA 230-257 Log in to see Polyclonal
1 ABIN4903386 FACS IF IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN5534395 FACS IF WB Rabbit Ig Fraction Log in to see Polyclonal
1 ABIN1811228 FACS IF IHC (p) WB Rabbit AA 230-257 Log in to see Polyclonal
1 ABIN2795018 FACS IF IHC WB Rabbit Ig Fraction Center Log in to see Polyclonal

Top referenced anti-CSF1 antibody for Immunofluorescence

Similar anti-CSF1 Antibodies

Application / Reactivity Human
Blocking Antibody (Inhibition) 1 Antibodies
ELISA 67 Antibodies
Flow Cytometry (FACS) 26 Antibodies
Functional Studies (Func) 1 Antibodies
Immunocytochemistry (ICC) 2 Antibodies
Immunofluorescence (IF) 9 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 1 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 13 Antibodies
Immunohistochemistry (IHC) 46 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 18 Antibodies
Immunoprecipitation (IP) 1 Antibodies
Neutralization (Neut) 12 Antibodies
Western Blotting (WB) 105 Antibodies

General

Antigen Colony Stimulating Factor 1 (Macrophage) (CSF1) Antibodies
Reactivity Human
(151), (55), (26), (6), (3), (3), (3), (1), (1), (1), (1)
Host Rabbit
(111), (59), (7), (3), (2)
Clonality
Polyclonal
Conjugate This CSF1 antibody is un-conjugated
(11), (7), (7), (4), (3), (3), (3), (3), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF)
(122), (86), (49), (27), (19), (18), (13), (8), (3), (2), (2), (2), (2), (1), (1)
Supplier Log in to see

Product Details anti-CSF1 Antibody

Target Details CSF1 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:('ETPVVKDSTIGGSPQPRPSVGAFNPGMEDILDSAMGTNWVPEEASGEASEIPVPQGTELSPSRPGGGSMQTEPARPSNFLSAS',)
Isotype IgG

Target Details CSF1

Product Details anti-CSF1 Antibody Application Details Handling Images back to top
Antigen
Alternative Name M-CSF (CSF1 Antibody Abstract)
Background Gene Symbol: CSF1
Gene ID 1435
Pathways RTK Signaling

Application Details

Product Details anti-CSF1 Antibody Target Details CSF1 Handling Images back to top
Application Notes Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-CSF1 Antibody Target Details CSF1 Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-CSF1 Antibody Target Details CSF1 Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-CSF1 antibody (Colony Stimulating Factor 1 (Macrophage)) (ABIN5077930) Immunocytochemistry/Immunofluorescence: M-CSF Antibody - Staining of human cell line...