You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human FGF3 antibody for Immunofluorescence

Recommended FGF3 Antibody (supplied by: Log in to see )

Antigen
Fibroblast Growth Factor 3 (FGF3) Antibodies
  • FGF-3
  • Fgf-3
  • fgf3-A
  • HBGF-3
  • id:ibd5006
  • INT-2
  • Int-2
  • Int-P
  • INT2
  • Int2
  • XFGF-3
  • xfgf3
Reactivity
Human
49
34
20
19
1
1
Host
Rabbit
29
25
Clonality
Polyclonal
Conjugate
This FGF3 antibody is un-conjugated
4
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
38
12
11
9
7
4
4
2
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4311605
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
0.0010791238 ABIN329823 ICC IF IHC WB Mouse IgG2a Log in to see

Similar anti-FGF3 Antibodies

Application / Reactivity Human
ELISA 10 Antibodies
Immunochromatography (IC) 1 Antibodies
Immunocytochemistry (ICC) 5 Antibodies
Immunofluorescence (IF) 2 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 11 Antibodies
Immunohistochemistry (IHC) 8 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 4 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 9 Antibodies
Immunoprecipitation (IP) 1 Antibodies
Neutralization (Neut) 2 Antibodies
Western Blotting (WB) 34 Antibodies

General

Antigen Fibroblast Growth Factor 3 (FGF3) Antibodies
Reactivity Human
(49), (34), (20), (19), (1), (1)
Host Rabbit
(29), (25)
Clonality
Polyclonal
Conjugate This FGF3 antibody is un-conjugated
(4), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(38), (12), (11), (9), (7), (4), (4), (2), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-FGF3 Antibody

Target Details FGF3 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RGRLYASEHYSAECEFVERIHELGYNTYASRLYRTVSSTPGARRQPSAERLWYVSVNGKGRPRRGFKTRRTQKSSLFLPRVLDHRDHEMVRQLQSGLPRPPGKGVQPRRRRQKQSPDNLEPS
Isotype IgG

Target Details FGF3

Product Details anti-FGF3 Antibody Application Details Handling Images back to top
Antigen
Alternative Name FGF-3 (FGF3 Antibody Abstract)
Background Gene Symbol: FGF3
Pathways RTK Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway

Application Details

Product Details anti-FGF3 Antibody Target Details FGF3 Handling Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-FGF3 Antibody Target Details FGF3 Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-FGF3 Antibody Target Details FGF3 Application Details Handling back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-FGF3 antibody (Fibroblast Growth Factor 3) (ABIN4311605) Immunohistochemistry-Paraffin: FGF-3 Antibody [NBP1-89718] - Staining of human placen...
Immunofluorescence (IF) image for anti-FGF3 antibody (Fibroblast Growth Factor 3) (ABIN4311605) Immunocytochemistry/Immunofluorescence: FGF-3 Antibody [NBP1-89718] - Staining of hum...