anti-Human TSC1 antibody for Immunofluorescence

Recommended TSC1 Antibody (supplied by: Log in to see )

Antigen
Tuberous Sclerosis 1 (TSC1) Antibodies
  • LAM
  • TSC
  • hamartin
  • mKIAA0243
  • tsc1
  • wu:fc38b04
  • TSC complex subunit 1
  • tuberous sclerosis 1
  • TSC complex subunit 1b
  • TSC1
  • Tsc1
  • tsc1b
  • tsc1
Reactivity
Human
461
378
171
28
7
6
5
1
1
Host
Rabbit
741
57
19
2
Clonality
Polyclonal
Conjugate
This TSC1 antibody is un-conjugated
67
67
67
64
64
64
5
5
5
5
5
3
3
3
3
3
3
2
2
Application
Immunocytochemistry (ICC), Immunofluorescence (IF)
532
519
165
66
39
34
28
21
16
8
4
2
2
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN5080330
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
11.946096 ABIN3029277 IF IHC ELISA WB Rabbit Ig Fraction AA 401-430 Log in to see Polyclonal
1 ABIN652207 IF IHC (p) WB Rabbit Ig AA 401-430, Center Log in to see Polyclonal 2
1 ABIN5555392 EIA IF WB Rabbit IgG Middle Region, both Isoforms Log in to see Polyclonal
1 ABIN303311 IF IHC (p) WB Rabbit Middle Region Log in to see Polyclonal
1 ABIN2650961 IF IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN5627135 ELISA ICC IF WB Rabbit IgG AA 220-270, all Isoforms Log in to see Polyclonal
1 ABIN4363049 ELISA ICC IF WB Rabbit all Isoforms Log in to see Polyclonal
1 ABIN4363048 ELISA ICC IF WB Rabbit all Isoforms Log in to see Polyclonal
1 ABIN2605251 ELISA IF IHC WB Rabbit IgG Internal Region Log in to see Polyclonal
1 ABIN2278826 IF IHC ELISA WB Rabbit IgG Center, Internal Region Log in to see Polyclonal
1 ABIN121908 IF WB Rabbit Log in to see Polyclonal 2
1 ABIN1900971 ELISA ICC IF IHC WB APC Rabbit IgG Internal Region Log in to see Polyclonal
1 ABIN1900973 ELISA ICC IF IHC WB Biotin Rabbit IgG Internal Region Log in to see Polyclonal
1 ABIN1900970 ELISA ICC IF IHC WB Alkaline Phosphatase (AP) Rabbit IgG Internal Region Log in to see Polyclonal
1 ABIN1900969 ELISA ICC IF IHC WB HRP Rabbit IgG Internal Region Log in to see Polyclonal
1 ABIN1900972 ELISA ICC IF IHC WB FITC Rabbit IgG Internal Region Log in to see Polyclonal
1 ABIN1900974 ELISA ICC IF IHC WB PE Rabbit IgG Internal Region Log in to see Polyclonal
1 ABIN2278830 IF IHC ELISA WB APC Rabbit IgG Center, Internal Region Log in to see Polyclonal
1 ABIN2278832 IF IHC ELISA WB FITC Rabbit IgG Center, Internal Region Log in to see Polyclonal
1 ABIN2278825 IF IHC ELISA WB PE Rabbit IgG Center, Internal Region Log in to see Polyclonal

General

Antigen Tuberous Sclerosis 1 (TSC1) Antibodies
Reactivity Human
(461), (378), (171), (28), (7), (6), (5), (1), (1)
Host Rabbit
(741), (57), (19), (2)
Clonality
Polyclonal
Conjugate This TSC1 antibody is un-conjugated
(67), (67), (67), (64), (64), (64), (5), (5), (5), (5), (5), (3), (3), (3), (3), (3), (3), (2), (2)
Application Immunocytochemistry (ICC), Immunofluorescence (IF)
(532), (519), (165), (66), (39), (34), (28), (21), (16), (8), (4), (2), (2), (1)
Supplier Log in to see

Product Details anti-TSC1 Antibody

Target Details TSC1 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DDYVHISLPQATVTPPRKEERMDSARPCLHRQHHLLNDRGSEEPPGSKGSVTLSDLPGFLGDLASEEDSIEKDKEEAAISRELSEITT
Isotype IgG

Target Details TSC1

Product Details anti-TSC1 Antibody Application Details Handling Images back to top
Antigen
Alternative Name TSC1 (TSC1 Antibody Abstract)
Background Gene Symbol: TSC1
Gene ID 7248
Pathways RTK Signaling, AMPK Signaling, Regulation of Cell Size, Tube Formation

Application Details

Product Details anti-TSC1 Antibody Target Details TSC1 Handling Images back to top
Application Notes Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-TSC1 Antibody Target Details TSC1 Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-TSC1 Antibody Target Details TSC1 Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-Tuberous Sclerosis 1 (TSC1) antibody (ABIN5080330) Immunocytochemistry/Immunofluorescence: TSC1 Antibody - Staining of human cell line ...