You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human CD83 antibody for Immunofluorescence

Recommended CD83 Antibody (supplied by: Log in to see )

CD83 Antibodies
  • BL11
  • HB15
  • CD83 molecule
  • CD83 antigen
  • Cd83
  • CD83
This CD83 antibody is un-conjugated
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Log in to see
Supplier Product No.
Log in to see

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4296241
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN2659323 FACS IF IP IHC PE-Cy7 Mouse IgG1 kappa Log in to see HB15e 7
1 ABIN263553 FACS IHC (fro) IF Mouse IgG2b Log in to see HB15A 6
1 ABIN2659753 FACS IF PE/Dazzle™ 594 Mouse IgG1 kappa Log in to see HB15e 5
1 ABIN2659754 FACS IF PE/Dazzle™ 594 Mouse IgG1 kappa Log in to see HB15e 5
1 ABIN2659324 FACS IF IP IHC PE-Cy7 Mouse IgG1 kappa Log in to see HB15e 7
1 ABIN2851723 FACS IF PE Mouse IgG1 Log in to see
1 ABIN2851653 FACS IF FITC Mouse IgG1 Log in to see
1 ABIN2472640 IHC (fro) FACS IF IHC (p) Mouse IgG1 Log in to see HB15e 4
1 ABIN2708055 FACS IF Mouse IgG1 Log in to see
1 ABIN251086 CyTOF FACS Func ICC IF IHC Mouse IgG1 Log in to see UCH-B1
1 ABIN211881 FACS IF IHC Mouse IgG2b, kappa Log in to see HB15a
1 ABIN2229038 FACS IF IHC FITC Mouse IgG2b kappa Log in to see 1-BB-583
1 ABIN2229035 FACS IF IHC Alkaline Phosphatase (AP) Mouse IgG2b kappa Log in to see 1-BB-583
1 ABIN2229037 FACS IF IHC Biotin Mouse IgG2b kappa Log in to see 1-BB-583
1 ABIN2229036 FACS IF IHC APC Mouse IgG2b kappa Log in to see 1-BB-583
1 ABIN2229040 FACS IF IHC PE Mouse IgG2b kappa Log in to see 1-BB-583
1 ABIN4296240 ICC IF IHC IHC (p) Rabbit Log in to see Polyclonal
1 ABIN2229021 FACS IF IHC Mouse IgG2b kappa Log in to see 1-BB-583

Top referenced anti-CD83 antibody for Immunofluorescence

Similar anti-CD83 Antibodies

Application / Reactivity Human
Biochemical Assay (BCA) 2 Antibodies
Cell Culture (CC) 1 Antibodies
Cytometry by Time of Flight (CyTOF) 2 Antibodies
ELISA 21 Antibodies
ELISA (Detection) 1 Antibodies
Enzyme Immunoassay (EIA) 1 Antibodies
Flow Cytometry (FACS) 150 Antibodies
Functional Studies (Func) 1 Antibodies
Immunocytochemistry (ICC) 5 Antibodies
Immunofluorescence (IF) 19 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 4 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 13 Antibodies
Immunohistochemistry (IHC) 56 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 16 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 27 Antibodies
Immunoprecipitation (IP) 8 Antibodies
Western Blotting (WB) 49 Antibodies


Antigen CD83 Antibodies
Reactivity Human
(218), (93), (40), (20), (15), (7), (5), (5), (5), (2), (1), (1)
Host Rabbit
(149), (69), (53), (8)
Conjugate This CD83 antibody is un-conjugated
(31), (25), (16), (13), (12), (6), (6), (5), (5), (4), (4), (4), (4), (4), (4), (4), (4), (4), (4), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(186), (57), (55), (29), (28), (26), (20), (16), (10), (6), (4), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-CD83 Antibody

Target Details CD83 Application Details Handling Images
Purification Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: PNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEET

Target Details CD83

Product Details anti-CD83 Antibody Application Details Handling Images back to top
Alternative Name CD83 (CD83 Antibody Abstract)
Background Gene Symbol: CD83
Gene ID 9308
UniProt Q01151
Research Area Adaptive Immunity, Immunology, Surface Receptors of Immune Cells, CD Antigens
Pathways TCR Signaling

Application Details

Product Details anti-CD83 Antibody Target Details CD83 Handling Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-CD83 Antibody Target Details CD83 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-CD83 Antibody Target Details CD83 Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-CD83 antibody (CD83) (ABIN4296241) Immunohistochemistry: CD83 Antibody [NBP2-38485] - Staining of human tonsil shows dis...
Immunofluorescence (IF) image for anti-CD83 antibody (CD83) (ABIN4296241) Immunocytochemistry/Immunofluorescence: CD83 Antibody [NBP2-38485] - Immunofluorescen...