anti-Human GRAP2 antibody for Immunocytochemistry

Recommended GRAP2 Antibody (supplied by: Log in to see )

Antigen
GRB2-Related Adaptor Protein 2 (GRAP2) Antibodies
  • zgc:112091
  • GRAP2
  • grap2
  • GADS
  • GRAP-2
  • GRB2L
  • GRBLG
  • GRID
  • GRPL
  • GrbX
  • Grf40
  • Mona
  • P38
  • Gads
  • GrpL
  • GRB2-related adaptor protein 2a
  • GRB2-related adaptor protein 2
  • grap2a
  • GRAP2
  • grap2
  • Grap2
Reactivity
Human
119
30
23
3
1
1
1
1
1
Host
Rabbit
79
31
16
1
Clonality
Polyclonal
Conjugate
This GRAP2 antibody is un-conjugated
7
7
5
4
4
4
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
106
57
23
15
13
12
10
3
3
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4316110
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN1859064 ICC IHC IP WB Rabbit IgG AA 77-325 Log in to see Polyclonal

Similar anti-GRAP2 Antibodies

Application / Reactivity Human
ELISA 52 Antibodies
Enzyme Immunoassay (EIA) 1 Antibodies
Flow Cytometry (FACS) 10 Antibodies
Immunocytochemistry (ICC) 2 Antibodies
Immunofluorescence (IF) 1 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 1 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 13 Antibodies
Immunohistochemistry (IHC) 20 Antibodies
Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) 1 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 13 Antibodies
Immunoprecipitation (IP) 13 Antibodies
Proximity Ligation Assay (PLA) 1 Antibodies
Western Blotting (WB) 99 Antibodies

General

Antigen GRB2-Related Adaptor Protein 2 (GRAP2) Antibodies
Reactivity Human
(119), (30), (23), (3), (1), (1), (1), (1), (1)
Host Rabbit
(79), (31), (16), (1)
Clonality
Polyclonal
Conjugate This GRAP2 antibody is un-conjugated
(7), (7), (5), (4), (4), (4), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(106), (57), (23), (15), (13), (12), (10), (3), (3), (1), (1), (1)
Supplier Log in to see

Product Details anti-GRAP2 Antibody

Target Details GRAP2 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:TNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVGEEIRPSMNRKLSDHPPTLPLQQHQHQPQPPQYAPAPQQLQQPPQQRYLQHHHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALYDFE
Isotype IgG

Target Details GRAP2

Product Details anti-GRAP2 Antibody Application Details Handling Images back to top
Antigen
Alternative Name GRAP2 (GRAP2 Antibody Abstract)
Background Gene Symbol: GRAP2
Gene ID 9402
Research Area Cancer
Pathways TCR Signaling, Fc-epsilon Receptor Signaling Pathway

Application Details

Product Details anti-GRAP2 Antibody Target Details GRAP2 Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200, ImmunofluorescenceFor IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-GRAP2 Antibody Target Details GRAP2 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-GRAP2 Antibody Target Details GRAP2 Application Details Handling back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-GRAP2 antibody (GRB2-Related Adaptor Protein 2) (ABIN4316110) Immunohistochemistry-Paraffin: GRAP2 Antibody [NBP1-83399] - Staining of human lymph ...
Western Blotting (WB) image for anti-GRAP2 antibody (GRB2-Related Adaptor Protein 2) (ABIN4316110) Western Blot: GRAP2 Antibody [NBP1-83399] - Lane 1: Marker [kDa] 220, 112, 84, 47, 32...
Immunofluorescence (IF) image for anti-GRAP2 antibody (GRB2-Related Adaptor Protein 2) (ABIN4316110) Immunofluorescence: GRAP2 Antibody [NBP1-83399] - Staining of human cell line U-251MG...