You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human DAAM1 antibody for Immunofluorescence

Recommended DAAM1 Antibody (supplied by: Log in to see )

Antigen
Dishevelled Associated Activator of Morphogenesis 1 (DAAM1) Antibodies
  • 1700066F09Rik
  • 2310028E21Rik
  • AI503486
  • daam-1
  • daam1
  • DAAM1
  • DKFZp468D0524
  • E130308H01
  • mKIAA0666
  • xdaam1
Reactivity
Human
75
14
13
3
3
2
2
1
1
Host
Rabbit
69
6
Clonality
Polyclonal
Conjugate
This DAAM1 antibody is un-conjugated
5
5
5
5
5
5
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
68
51
43
8
8
4
2
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4304200
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
0.00108597 ABIN1085278 IF IHC ELISA WB Rabbit IgG Log in to see Polyclonal
0.00108597 ABIN1085277 IF IHC ELISA WB Rabbit IgG Log in to see Polyclonal
0.00108597 ABIN2138848 IF IHC ELISA WB Rabbit IgG Log in to see Polyclonal
0.00108597 ABIN3060964 ICC IF IP IHC WB Rabbit Log in to see Polyclonal

Similar anti-DAAM1 Antibodies

Application / Reactivity Human
ELISA 51 Antibodies
Enzyme Immunoassay (EIA) 2 Antibodies
Flow Cytometry (FACS) 8 Antibodies
Immunocytochemistry (ICC) 2 Antibodies
Immunofluorescence (IF) 5 Antibodies
Immunohistochemistry (IHC) 44 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 9 Antibodies
Immunoprecipitation (IP) 1 Antibodies
Proximity Ligation Assay (PLA) 1 Antibodies
Western Blotting (WB) 68 Antibodies

General

Antigen Dishevelled Associated Activator of Morphogenesis 1 (DAAM1) Antibodies
Reactivity Human
(75), (14), (13), (3), (3), (2), (2), (1), (1)
Host Rabbit
(69), (6)
Clonality
Polyclonal
Conjugate This DAAM1 antibody is un-conjugated
(5), (5), (5), (5), (5), (5)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(68), (51), (43), (8), (8), (4), (2), (1), (1), (1)
Supplier Log in to see

Product Details anti-DAAM1 Antibody

Target Details DAAM1 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:QNDKGQDPDSTPLENFNIKNVVRMLVNENEVKQWKEQAEKMRKEHNELQQKLEKKERECDAKTQEKEEMMQTLNKMKEKLEKETTEHKQVKQQVADLTAQLHELSRRAVCASIPG
Isotype IgG

Target Details DAAM1

Product Details anti-DAAM1 Antibody Application Details Handling Images back to top
Antigen
Alternative Name DAAM1 (DAAM1 Antibody Abstract)
Background Gene Symbol: DAAM1
Pathways WNT Signaling

Application Details

Product Details anti-DAAM1 Antibody Target Details DAAM1 Handling Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-DAAM1 Antibody Target Details DAAM1 Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-DAAM1 Antibody Target Details DAAM1 Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-DAAM1 antibody (Dishevelled Associated Activator of Morphogenesis 1) (ABIN4304200) Immunocytochemistry/Immunofluorescence: DAAM1 Antibody [NBP1-81492] Staining of human...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-DAAM1 antibody (Dishevelled Associated Activator of Morphogenesis 1) (ABIN4304200) Immunohistochemistry-Paraffin: DAAM1 Antibody [NBP1-81492] - Immunohistochemical stai...