anti-Human DAAM1 antibody for Immunofluorescence

Recommended DAAM1 Antibody (supplied by: Log in to see )

Antigen
Dishevelled Associated Activator of Morphogenesis 1 (DAAM1) Antibodies
  • daam-1
  • xdaam1
  • DAAM1
  • DKFZp468D0524
  • 1700066F09Rik
  • 2310028E21Rik
  • AI503486
  • E130308H01
  • mKIAA0666
  • daam1
  • dishevelled associated activator of morphogenesis 1
  • dishevelled associated activator of morphogenesis 1a
  • daam1
  • DAAM1
  • Daam1
  • daam1a
Reactivity
Human
77
16
16
9
5
5
4
2
2
2
1
1
1
Host
Rabbit
71
6
Clonality
Polyclonal
Conjugate
This DAAM1 antibody is un-conjugated
5
5
5
5
5
5
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
73
49
45
10
9
5
3
2
2
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4304200
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
11.176395 ABIN5076191 ICC IF Rabbit IgG Log in to see Polyclonal
1 ABIN1085277 IF IHC ELISA WB Rabbit IgG Log in to see Polyclonal
1 ABIN1085278 IF IHC ELISA WB Rabbit IgG Log in to see Polyclonal
1 ABIN2138848 IF IHC ELISA WB Rabbit IgG Log in to see Polyclonal
1 ABIN3060964 ICC IF IP IHC WB Rabbit Log in to see Polyclonal

General

Antigen Dishevelled Associated Activator of Morphogenesis 1 (DAAM1) Antibodies
Reactivity Human
(77), (16), (16), (9), (5), (5), (4), (2), (2), (2), (1), (1), (1)
Host Rabbit
(71), (6)
Clonality
Polyclonal
Conjugate This DAAM1 antibody is un-conjugated
(5), (5), (5), (5), (5), (5)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(73), (49), (45), (10), (9), (5), (3), (2), (2), (1), (1)
Supplier Log in to see

Product Details anti-DAAM1 Antibody

Target Details DAAM1 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:QNDKGQDPDSTPLENFNIKNVVRMLVNENEVKQWKEQAEKMRKEHNELQQKLEKKERECDAKTQEKEEMMQTLNKMKEKLEKETTEHKQVKQQVADLTAQLHELSRRAVCASIPG
Isotype IgG

Target Details DAAM1

Product Details anti-DAAM1 Antibody Application Details Handling Images back to top
Antigen
Alternative Name DAAM1 (DAAM1 Antibody Abstract)
Background Gene Symbol: DAAM1
Gene ID 23002
Pathways WNT Signaling

Application Details

Product Details anti-DAAM1 Antibody Target Details DAAM1 Handling Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-DAAM1 Antibody Target Details DAAM1 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-DAAM1 Antibody Target Details DAAM1 Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-Dishevelled Associated Activator of Morphogenesis 1 (DAAM1) antibody (ABIN4304200) Immunocytochemistry/Immunofluorescence: DAAM1 Antibody [NBP1-81492] Staining of human...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Dishevelled Associated Activator of Morphogenesis 1 (DAAM1) antibody (ABIN4304200) Immunohistochemistry-Paraffin: DAAM1 Antibody [NBP1-81492] - Immunohistochemical stai...